Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 1099296..1099954 | Replicon | chromosome |
Accession | NZ_CP115456 | ||
Organism | Sphingobium yanoikuyae strain CC4533 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PAE53_RS05340 | Protein ID | WP_270092839.1 |
Coordinates | 1099296..1099703 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PAE53_RS05345 | Protein ID | WP_270092840.1 |
Coordinates | 1099700..1099954 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAE53_RS05315 (PAE53_05315) | 1095263..1095928 | - | 666 | WP_270092834.1 | OmpW family outer membrane protein | - |
PAE53_RS05320 (PAE53_05320) | 1096659..1097135 | + | 477 | WP_270092835.1 | RNA polymerase sigma factor | - |
PAE53_RS05325 (PAE53_05325) | 1097527..1097841 | + | 315 | WP_270092836.1 | helix-turn-helix transcriptional regulator | - |
PAE53_RS05330 (PAE53_05330) | 1097878..1098243 | - | 366 | WP_270092837.1 | hypothetical protein | - |
PAE53_RS05335 (PAE53_05335) | 1098362..1099285 | - | 924 | WP_270092838.1 | HEPN domain-containing protein | - |
PAE53_RS05340 (PAE53_05340) | 1099296..1099703 | - | 408 | WP_270092839.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PAE53_RS05345 (PAE53_05345) | 1099700..1099954 | - | 255 | WP_270092840.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PAE53_RS05350 (PAE53_05350) | 1100251..1100367 | + | 117 | Protein_1057 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
PAE53_RS05355 (PAE53_05355) | 1100377..1100661 | - | 285 | WP_270093764.1 | hypothetical protein | - |
PAE53_RS05360 (PAE53_05360) | 1101373..1101564 | - | 192 | WP_270092841.1 | hypothetical protein | - |
PAE53_RS05365 (PAE53_05365) | 1102343..1103713 | + | 1371 | WP_088184704.1 | IS1380 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 1077635..1212390 | 134755 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15030.04 Da Isoelectric Point: 4.5348
>T267151 WP_270092839.1 NZ_CP115456:c1099703-1099296 [Sphingobium yanoikuyae]
VIVDTSALVAILYREEEAEDFADLIQRADICRMSVATYLELTLVIEKQLGPEGTRHAENFIRRAGIQIEPVTVEQGLIAR
QAFFDFGKGRHSAALNYGDCFPYALAKAVDEPLLFKGNDFSQTDVESALPRARPQ
VIVDTSALVAILYREEEAEDFADLIQRADICRMSVATYLELTLVIEKQLGPEGTRHAENFIRRAGIQIEPVTVEQGLIAR
QAFFDFGKGRHSAALNYGDCFPYALAKAVDEPLLFKGNDFSQTDVESALPRARPQ
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|