Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 6417585..6418213 | Replicon | chromosome |
Accession | NZ_CP115450 | ||
Organism | Kitasatospora sp. HUAS 3-15 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | O1G21_RS28790 | Protein ID | WP_270147750.1 |
Coordinates | 6417803..6418213 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | O1G21_RS28785 | Protein ID | WP_270147748.1 |
Coordinates | 6417585..6417806 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O1G21_RS28765 (O1G21_28765) | 6412700..6414475 | + | 1776 | WP_270147744.1 | DEAD/DEAH box helicase | - |
O1G21_RS28770 (O1G21_28770) | 6415065..6415460 | + | 396 | Protein_5653 | ricin-type beta-trefoil lectin domain protein | - |
O1G21_RS28775 (O1G21_28775) | 6415529..6416377 | - | 849 | WP_270147745.1 | helix-turn-helix transcriptional regulator | - |
O1G21_RS28780 (O1G21_28780) | 6416491..6417504 | + | 1014 | WP_270147747.1 | hypothetical protein | - |
O1G21_RS28785 (O1G21_28785) | 6417585..6417806 | + | 222 | WP_270147748.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
O1G21_RS28790 (O1G21_28790) | 6417803..6418213 | + | 411 | WP_270147750.1 | PIN domain-containing protein | Toxin |
O1G21_RS28795 (O1G21_28795) | 6418227..6418955 | - | 729 | WP_270147752.1 | sirohydrochlorin chelatase | - |
O1G21_RS28800 (O1G21_28800) | 6418966..6419859 | - | 894 | WP_270147754.1 | ABC transporter permease | - |
O1G21_RS28805 (O1G21_28805) | 6419846..6420646 | - | 801 | WP_270147756.1 | ABC transporter ATP-binding protein | - |
O1G21_RS28810 (O1G21_28810) | 6420765..6421916 | - | 1152 | WP_270147758.1 | aliphatic sulfonate ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15233.26 Da Isoelectric Point: 5.5523
>T267150 WP_270147750.1 NZ_CP115450:6417803-6418213 [Kitasatospora sp. HUAS 3-15]
VIYLIDTSALFRLMRDPKLKTAWYDAIDAGSIASCYPQRAELLFSARDGREYDEISELFAELYPDVSVPKNAGRWIDMVQ
RRMALAGRHRSASAVDLMIAATAAHHGLTVLHDDADYRTVARYATDLSEHSILDCA
VIYLIDTSALFRLMRDPKLKTAWYDAIDAGSIASCYPQRAELLFSARDGREYDEISELFAELYPDVSVPKNAGRWIDMVQ
RRMALAGRHRSASAVDLMIAATAAHHGLTVLHDDADYRTVARYATDLSEHSILDCA
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|