Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-PHD |
Location | 3307046..3307728 | Replicon | chromosome |
Accession | NZ_CP115450 | ||
Organism | Kitasatospora sp. HUAS 3-15 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | O1G21_RS14500 | Protein ID | WP_270143941.1 |
Coordinates | 3307046..3307450 (-) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | O1G21_RS14505 | Protein ID | WP_270143943.1 |
Coordinates | 3307447..3307728 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O1G21_RS14490 (O1G21_14490) | 3303009..3304499 | + | 1491 | WP_270143937.1 | maltokinase | - |
O1G21_RS14495 (O1G21_14495) | 3304598..3307009 | + | 2412 | WP_270143939.1 | 1,4-alpha-glucan branching protein GlgB | - |
O1G21_RS14500 (O1G21_14500) | 3307046..3307450 | - | 405 | WP_270143941.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
O1G21_RS14505 (O1G21_14505) | 3307447..3307728 | - | 282 | WP_270143943.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
O1G21_RS14510 (O1G21_14510) | 3307906..3310065 | + | 2160 | WP_270143945.1 | phosphate acetyltransferase | - |
O1G21_RS14515 (O1G21_14515) | 3310166..3311389 | + | 1224 | WP_270143947.1 | acetate kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14876.08 Da Isoelectric Point: 5.6761
>T267147 WP_270143941.1 NZ_CP115450:c3307450-3307046 [Kitasatospora sp. HUAS 3-15]
MIYLDSCALLKFIKPEPETAALRAWREALPDGTELITSELARLEITRTLLRAGLSHQLVPYHVDQALRGAYQVDLSSAVL
ARALAYRTPRLGSLDALHLASAEPFRAELTDFVTYDRELARAAEELGFPVTAPR
MIYLDSCALLKFIKPEPETAALRAWREALPDGTELITSELARLEITRTLLRAGLSHQLVPYHVDQALRGAYQVDLSSAVL
ARALAYRTPRLGSLDALHLASAEPFRAELTDFVTYDRELARAAEELGFPVTAPR
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|