Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 3704313..3704938 | Replicon | chromosome |
| Accession | NZ_CP115447 | ||
| Organism | Mycobacterium tuberculosis strain BLR 9248 2019 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQA0 |
| Locus tag | PAK35_RS17500 | Protein ID | WP_003403218.1 |
| Coordinates | 3704313..3704714 (-) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ36 |
| Locus tag | PAK35_RS17505 | Protein ID | WP_003403213.1 |
| Coordinates | 3704711..3704938 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PAK35_RS17475 (PAK35_17475) | 3699403..3700350 | - | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
| PAK35_RS17480 (PAK35_17480) | 3700454..3701518 | - | 1065 | WP_003898532.1 | zinc ribbon domain-containing protein | - |
| PAK35_RS17485 (PAK35_17485) | 3701913..3703004 | - | 1092 | WP_003900977.1 | galactokinase | - |
| PAK35_RS17490 (PAK35_17490) | 3703001..3704082 | - | 1082 | Protein_3454 | galactose-1-phosphate uridylyltransferase | - |
| PAK35_RS17495 (PAK35_17495) | 3704101..3704184 | - | 84 | Protein_3455 | galactose-1-phosphate uridylyltransferase | - |
| PAK35_RS17500 (PAK35_17500) | 3704313..3704714 | - | 402 | WP_003403218.1 | type II toxin-antitoxin system ribonuclease VapC29 | Toxin |
| PAK35_RS17505 (PAK35_17505) | 3704711..3704938 | - | 228 | WP_003403213.1 | antitoxin VapB29 | Antitoxin |
| PAK35_RS17510 (PAK35_17510) | 3705133..3705375 | - | 243 | WP_003403210.1 | hypothetical protein | - |
| PAK35_RS17515 (PAK35_17515) | 3705372..3706121 | - | 750 | WP_003898528.1 | hypothetical protein | - |
| PAK35_RS17520 (PAK35_17520) | 3706205..3708772 | + | 2568 | WP_003901879.1 | SEC-C metal-binding domain-containing protein | - |
| PAK35_RS17525 (PAK35_17525) | 3708791..3709396 | - | 606 | WP_003898526.1 | hypothetical protein | - |
| PAK35_RS17530 (PAK35_17530) | 3709538..3709759 | + | 222 | WP_003898525.1 | DUF4926 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 13937.76 Da Isoelectric Point: 5.7441
>T267142 WP_003403218.1 NZ_CP115447:c3704714-3704313 [Mycobacterium tuberculosis]
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQA0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BSC9 |