Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-PHD |
Location | 3697031..3697695 | Replicon | chromosome |
Accession | NZ_CP115447 | ||
Organism | Mycobacterium tuberculosis strain BLR 9248 2019 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P96917 |
Locus tag | PAK35_RS17450 | Protein ID | WP_003403246.1 |
Coordinates | 3697031..3697438 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WF18 |
Locus tag | PAK35_RS17455 | Protein ID | WP_003403244.1 |
Coordinates | 3697435..3697695 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAK35_RS17440 (PAK35_17440) | 3693988..3695715 | + | 1728 | WP_003901883.1 | exodeoxyribonuclease V subunit alpha | - |
PAK35_RS17445 (PAK35_17445) | 3695808..3696959 | + | 1152 | WP_003403248.1 | FIST N-terminal domain-containing protein | - |
PAK35_RS17450 (PAK35_17450) | 3697031..3697438 | - | 408 | WP_003403246.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PAK35_RS17455 (PAK35_17455) | 3697435..3697695 | - | 261 | WP_003403244.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PAK35_RS17460 (PAK35_17460) | 3697827..3698567 | + | 741 | WP_003403239.1 | TVP38/TMEM64 family protein | - |
PAK35_RS17465 (PAK35_17465) | 3698661..3699056 | - | 396 | WP_003403236.1 | type II toxin-antitoxin system toxin ribonuclease C30 | - |
PAK35_RS17470 (PAK35_17470) | 3699056..3699310 | - | 255 | WP_003403235.1 | type II toxin-antitoxin system antitoxin VapB30 | - |
PAK35_RS17475 (PAK35_17475) | 3699403..3700350 | - | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
PAK35_RS17480 (PAK35_17480) | 3700454..3701518 | - | 1065 | WP_003898532.1 | zinc ribbon domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14376.37 Da Isoelectric Point: 4.3568
>T267140 WP_003403246.1 NZ_CP115447:c3697438-3697031 [Mycobacterium tuberculosis]
VSTTPAAGVLDTSVFIATESGRQLDEALIPDRVATTVVTLAELRVGVLAAATTDIRAQRLATLESVADMETLPVDDDAAR
MWARLRIHLAESGRRVRINDLWIAAVAASRALPVITQDDDFAALDGAASVEIIRV
VSTTPAAGVLDTSVFIATESGRQLDEALIPDRVATTVVTLAELRVGVLAAATTDIRAQRLATLESVADMETLPVDDDAAR
MWARLRIHLAESGRRVRINDLWIAAVAASRALPVITQDDDFAALDGAASVEIIRV
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 3DBO |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 3DBO | |
AlphaFold DB | A0A7U4BSE4 |