Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapC-mazE/PIN(toxin) |
Location | 3659415..3660207 | Replicon | chromosome |
Accession | NZ_CP115447 | ||
Organism | Mycobacterium tuberculosis strain BLR 9248 2019 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WFB2 |
Locus tag | PAK35_RS17255 | Protein ID | WP_003403386.1 |
Coordinates | 3659415..3659852 (+) | Length | 146 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TQE0 |
Locus tag | PAK35_RS17260 | Protein ID | WP_003403381.1 |
Coordinates | 3659962..3660207 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAK35_RS17230 (PAK35_17230) | 3655878..3656051 | - | 174 | WP_003898549.1 | hypothetical protein | - |
PAK35_RS17235 (PAK35_17235) | 3656048..3656386 | - | 339 | WP_003403405.1 | PIN domain-containing protein | - |
PAK35_RS17240 (PAK35_17240) | 3656298..3656624 | - | 327 | WP_003403401.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
PAK35_RS17245 (PAK35_17245) | 3656687..3659050 | - | 2364 | WP_003901895.1 | arylsulfatase AtsD | - |
PAK35_RS17250 (PAK35_17250) | 3659164..3659418 | + | 255 | WP_003911263.1 | antitoxin VapB7 | - |
PAK35_RS17255 (PAK35_17255) | 3659415..3659852 | + | 438 | WP_003403386.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PAK35_RS17260 (PAK35_17260) | 3659962..3660207 | + | 246 | WP_003403381.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
PAK35_RS17265 (PAK35_17265) | 3660194..3660502 | + | 309 | WP_003403376.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
PAK35_RS17270 (PAK35_17270) | 3660778..3661494 | + | 717 | WP_003403371.1 | CPBP family intramembrane metalloprotease | - |
PAK35_RS17275 (PAK35_17275) | 3661570..3661725 | + | 156 | WP_003403368.1 | type II toxin-antitoxin system VapB family antitoxin | - |
PAK35_RS17280 (PAK35_17280) | 3661820..3662203 | + | 384 | WP_003403365.1 | ribonuclease VapC6 | - |
PAK35_RS17285 (PAK35_17285) | 3662591..3663601 | - | 1011 | WP_003911248.1 | ABC transporter ATP-binding protein | - |
PAK35_RS17290 (PAK35_17290) | 3663682..3665187 | - | 1506 | WP_003403360.1 | carotenoid cleavage oxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 15245.39 Da Isoelectric Point: 5.1865
>T267137 WP_003403386.1 NZ_CP115447:3659415-3659852 [Mycobacterium tuberculosis]
MIVLDTTVLVYAKGAEHPLRDPCRDLVAAIADERIAATTTAEVIQEFVHVRARRRDRSDAAALGRVTMPNCSRRYSPSIE
ATSKRGLTLFETTPGLEACDAVLAAVAASAGATALVSADPAFADLSDVVHVIPDAAGMVSLLGDR
MIVLDTTVLVYAKGAEHPLRDPCRDLVAAIADERIAATTTAEVIQEFVHVRARRRDRSDAAALGRVTMPNCSRRYSPSIE
ATSKRGLTLFETTPGLEACDAVLAAVAASAGATALVSADPAFADLSDVVHVIPDAAGMVSLLGDR
Download Length: 438 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BSW5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQE0 |