Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 3573550..3574259 | Replicon | chromosome |
Accession | NZ_CP115447 | ||
Organism | Mycobacterium tuberculosis strain BLR 9248 2019 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WF74 |
Locus tag | PAK35_RS16780 | Protein ID | WP_003403837.1 |
Coordinates | 3573550..3573978 (-) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PAK35_RS16785 | Protein ID | WP_050177415.1 |
Coordinates | 3574002..3574259 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAK35_RS16755 (PAK35_16755) | 3569253..3570785 | + | 1533 | WP_003403847.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
PAK35_RS16760 (PAK35_16760) | 3570792..3571964 | + | 1173 | WP_003403845.1 | acyl-CoA dehydrogenase family protein | - |
PAK35_RS16765 (PAK35_16765) | 3571975..3572859 | + | 885 | WP_003403844.1 | 3-hydroxyisobutyrate dehydrogenase | - |
PAK35_RS16770 (PAK35_16770) | 3572928..3573173 | - | 246 | WP_003403841.1 | hypothetical protein | - |
PAK35_RS16775 (PAK35_16775) | 3573332..3573469 | + | 138 | WP_003403839.1 | hypothetical protein | - |
PAK35_RS16780 (PAK35_16780) | 3573550..3573978 | - | 429 | WP_003403837.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PAK35_RS16785 (PAK35_16785) | 3574002..3574259 | - | 258 | WP_050177415.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
PAK35_RS16790 (PAK35_16790) | 3574350..3576623 | - | 2274 | WP_016330384.1 | PE family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15831.27 Da Isoelectric Point: 7.5536
>T267135 WP_003403837.1 NZ_CP115447:c3573978-3573550 [Mycobacterium tuberculosis]
MFLLDANVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWASFLRLATNRRIFEIPSPRAEAFAFVEAVTAQPHHL
PTNPGPRHLMLLRKLCDEADASGDLIPDAVLAAIAVGHHCAVVSLDRDFARFASVRHIRPPL
MFLLDANVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWASFLRLATNRRIFEIPSPRAEAFAFVEAVTAQPHHL
PTNPGPRHLMLLRKLCDEADASGDLIPDAVLAAIAVGHHCAVVSLDRDFARFASVRHIRPPL
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|