Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | unclassified/Polyketide_cyc2(toxin) |
Location | 3400187..3400806 | Replicon | chromosome |
Accession | NZ_CP115447 | ||
Organism | Mycobacterium tuberculosis strain BLR 9248 2019 |
Toxin (Protein)
Gene name | novel[antitoxin] | Uniprot ID | - |
Locus tag | PAK35_RS15940 | Protein ID | WP_003404726.1 |
Coordinates | 3400187..3400621 (-) | Length | 145 a.a. |
Antitoxin (Protein)
Gene name | novel[toxin] | Uniprot ID | P9WJ06 |
Locus tag | PAK35_RS15945 | Protein ID | WP_003898641.1 |
Coordinates | 3400627..3400806 (-) | Length | 60 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAK35_RS15915 (PAK35_15915) | 3395522..3396760 | + | 1239 | WP_003404744.1 | acetyl-CoA acetyltransferase | - |
PAK35_RS15920 (PAK35_15920) | 3396762..3398270 | + | 1509 | WP_003404742.1 | carotenoid oxygenase family protein | - |
PAK35_RS15925 (PAK35_15925) | 3398437..3398667 | + | 231 | WP_003898642.1 | hypothetical protein | - |
PAK35_RS15930 (PAK35_15930) | 3398802..3399251 | - | 450 | WP_003404738.1 | hypothetical protein | - |
PAK35_RS15935 (PAK35_15935) | 3399316..3400089 | - | 774 | WP_003404735.1 | VOC family protein | - |
PAK35_RS15940 (PAK35_15940) | 3400187..3400621 | - | 435 | WP_003404726.1 | SRPBCC family protein | Toxin |
PAK35_RS15945 (PAK35_15945) | 3400627..3400806 | - | 180 | WP_003898641.1 | antitoxin | Antitoxin |
PAK35_RS15950 (PAK35_15950) | 3400932..3401090 | - | 159 | WP_003404720.1 | hypothetical protein | - |
PAK35_RS15955 (PAK35_15955) | 3401363..3403756 | - | 2394 | WP_003898639.1 | cation-translocating P-type ATPase | - |
PAK35_RS15960 (PAK35_15960) | 3403753..3405333 | - | 1581 | WP_003910977.1 | serine hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15754.47 Da Isoelectric Point: 9.7977
>T267134 WP_003404726.1 NZ_CP115447:c3400621-3400187 [Mycobacterium tuberculosis]
MAKLSGSIDVPLPPEEAWMHASDLTRYREWLTIHKVWRSKLPEVLEKGTVVESYVEVKGMPNRIKWTIVRYKPPEGMTLN
GDGVGGVKVKLIAKVAPKEHGSVVSFDVHLGGPALLGPIGMIVAAALRADIRESLQNFVTVFAG
MAKLSGSIDVPLPPEEAWMHASDLTRYREWLTIHKVWRSKLPEVLEKGTVVESYVEVKGMPNRIKWTIVRYKPPEGMTLN
GDGVGGVKVKLIAKVAPKEHGSVVSFDVHLGGPALLGPIGMIVAAALRADIRESLQNFVTVFAG
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|