Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 3175333..3175901 | Replicon | chromosome |
| Accession | NZ_CP115447 | ||
| Organism | Mycobacterium tuberculosis strain BLR 9248 2019 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TH08 |
| Locus tag | PAK35_RS14830 | Protein ID | WP_003405865.1 |
| Coordinates | 3175333..3175707 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TH07 |
| Locus tag | PAK35_RS14835 | Protein ID | WP_003405863.1 |
| Coordinates | 3175704..3175901 (-) | Length | 66 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PAK35_RS14795 (PAK35_14795) | 3171683..3172453 | + | 771 | Protein_2927 | adenylate/guanylate cyclase domain-containing protein | - |
| PAK35_RS14800 (PAK35_14800) | 3172405..3172614 | - | 210 | WP_003911400.1 | hypothetical protein | - |
| PAK35_RS14805 (PAK35_14805) | 3172648..3173346 | + | 699 | WP_031646953.1 | hypothetical protein | - |
| PAK35_RS14810 (PAK35_14810) | 3173361..3173684 | - | 324 | WP_003405871.1 | putative quinol monooxygenase | - |
| PAK35_RS14815 (PAK35_14815) | 3173927..3174202 | + | 276 | WP_003405867.1 | hypothetical protein | - |
| PAK35_RS14820 (PAK35_14820) | 3174129..3174314 | - | 186 | WP_003901093.1 | hypothetical protein | - |
| PAK35_RS14825 (PAK35_14825) | 3174432..3175130 | - | 699 | WP_003898733.1 | hypothetical protein | - |
| PAK35_RS14830 (PAK35_14830) | 3175333..3175707 | - | 375 | WP_003405865.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PAK35_RS14835 (PAK35_14835) | 3175704..3175901 | - | 198 | WP_003405863.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PAK35_RS14840 (PAK35_14840) | 3175989..3177062 | - | 1074 | WP_003898732.1 | redox-regulated ATPase YchF | - |
| PAK35_RS14845 (PAK35_14845) | 3177125..3178108 | + | 984 | WP_003898731.1 | hypothetical protein | - |
| PAK35_RS14850 (PAK35_14850) | 3178125..3179132 | - | 1008 | WP_003405853.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
| PAK35_RS14855 (PAK35_14855) | 3179222..3179860 | + | 639 | WP_003898730.1 | lipid droplet-associated protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13444.56 Da Isoelectric Point: 5.1881
>T267131 WP_003405865.1 NZ_CP115447:c3175707-3175333 [Mycobacterium tuberculosis]
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|