Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 3175333..3175901 Replicon chromosome
Accession NZ_CP115447
Organism Mycobacterium tuberculosis strain BLR 9248 2019

Toxin (Protein)


Gene name vapC Uniprot ID G0TH08
Locus tag PAK35_RS14830 Protein ID WP_003405865.1
Coordinates 3175333..3175707 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TH07
Locus tag PAK35_RS14835 Protein ID WP_003405863.1
Coordinates 3175704..3175901 (-) Length 66 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PAK35_RS14795 (PAK35_14795) 3171683..3172453 + 771 Protein_2927 adenylate/guanylate cyclase domain-containing protein -
PAK35_RS14800 (PAK35_14800) 3172405..3172614 - 210 WP_003911400.1 hypothetical protein -
PAK35_RS14805 (PAK35_14805) 3172648..3173346 + 699 WP_031646953.1 hypothetical protein -
PAK35_RS14810 (PAK35_14810) 3173361..3173684 - 324 WP_003405871.1 putative quinol monooxygenase -
PAK35_RS14815 (PAK35_14815) 3173927..3174202 + 276 WP_003405867.1 hypothetical protein -
PAK35_RS14820 (PAK35_14820) 3174129..3174314 - 186 WP_003901093.1 hypothetical protein -
PAK35_RS14825 (PAK35_14825) 3174432..3175130 - 699 WP_003898733.1 hypothetical protein -
PAK35_RS14830 (PAK35_14830) 3175333..3175707 - 375 WP_003405865.1 type II toxin-antitoxin system VapC family toxin Toxin
PAK35_RS14835 (PAK35_14835) 3175704..3175901 - 198 WP_003405863.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PAK35_RS14840 (PAK35_14840) 3175989..3177062 - 1074 WP_003898732.1 redox-regulated ATPase YchF -
PAK35_RS14845 (PAK35_14845) 3177125..3178108 + 984 WP_003898731.1 hypothetical protein -
PAK35_RS14850 (PAK35_14850) 3178125..3179132 - 1008 WP_003405853.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -
PAK35_RS14855 (PAK35_14855) 3179222..3179860 + 639 WP_003898730.1 lipid droplet-associated protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-111)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13444.56 Da        Isoelectric Point: 5.1881

>T267131 WP_003405865.1 NZ_CP115447:c3175707-3175333 [Mycobacterium tuberculosis]
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS

Download         Length: 375 bp

Antitoxin


Download         Length: 66 a.a.        Molecular weight: 6973.03 Da        Isoelectric Point: 11.7327

>AT267131 WP_003405863.1 NZ_CP115447:c3175901-3175704 [Mycobacterium tuberculosis]
MRTTVTVDDALLAKAAELTGVKEKSTLLREGLQTLVRVESARRLAALGGTDPQATAAPRRRTSPR

Download         Length: 198 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TH08

Antitoxin

Source ID Structure
AlphaFold DB G0TH07

References