Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2952970..2953657 | Replicon | chromosome |
Accession | NZ_CP115447 | ||
Organism | Mycobacterium tuberculosis strain BLR 9248 2019 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P65044 |
Locus tag | PAK35_RS13925 | Protein ID | WP_003414624.1 |
Coordinates | 2953214..2953657 (+) | Length | 148 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TFH0 |
Locus tag | PAK35_RS13920 | Protein ID | WP_003414620.1 |
Coordinates | 2952970..2953227 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAK35_RS13900 (PAK35_13900) | 2948290..2949144 | - | 855 | WP_003899516.1 | GNAT family N-acetyltransferase | - |
PAK35_RS13905 (PAK35_13905) | 2949200..2950363 | - | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
PAK35_RS13910 (PAK35_13910) | 2950380..2951594 | - | 1215 | WP_003414610.1 | zinc metalloprotease Rip | - |
PAK35_RS13915 (PAK35_13915) | 2951602..2952843 | - | 1242 | WP_003414613.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
PAK35_RS13920 (PAK35_13920) | 2952970..2953227 | + | 258 | WP_003414620.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
PAK35_RS13925 (PAK35_13925) | 2953214..2953657 | + | 444 | WP_003414624.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PAK35_RS13930 (PAK35_13930) | 2953737..2954399 | + | 663 | WP_003414630.1 | cell surface glycolipoprotein Mpt83 | - |
PAK35_RS13935 (PAK35_13935) | 2954495..2954686 | + | 192 | WP_003414632.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
PAK35_RS13940 (PAK35_13940) | 2955018..2956766 | + | 1749 | WP_003912869.1 | cytochrome c biogenesis protein DipZ | - |
PAK35_RS13945 (PAK35_13945) | 2956862..2957443 | + | 582 | WP_003414644.1 | fasciclin domain-containing protein | - |
PAK35_RS13950 (PAK35_13950) | 2957543..2957809 | + | 267 | WP_015456449.1 | DUF2631 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16595.72 Da Isoelectric Point: 6.4890
>T267130 WP_003414624.1 NZ_CP115447:2953214-2953657 [Mycobacterium tuberculosis]
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|