Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 2947369..2947917 | Replicon | chromosome |
Accession | NZ_CP115447 | ||
Organism | Mycobacterium tuberculosis strain BLR 9248 2019 |
Toxin (Protein)
Gene name | relE | Uniprot ID | G0TFG5 |
Locus tag | PAK35_RS13895 | Protein ID | WP_003414602.1 |
Coordinates | 2947654..2947917 (+) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | O33347 |
Locus tag | PAK35_RS13890 | Protein ID | WP_003414599.1 |
Coordinates | 2947369..2947650 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAK35_RS13865 (PAK35_13865) | 2942993..2943850 | - | 858 | WP_003899513.1 | type I methionyl aminopeptidase | - |
PAK35_RS13870 (PAK35_13870) | 2943892..2944476 | - | 585 | WP_003414585.1 | DUF1707 domain-containing protein | - |
PAK35_RS13875 (PAK35_13875) | 2944579..2944827 | + | 249 | WP_003913411.1 | antitoxin VapB23 | - |
PAK35_RS13880 (PAK35_13880) | 2944824..2945204 | + | 381 | WP_003414592.1 | type II toxin-antitoxin system VapC family toxin | - |
PAK35_RS13885 (PAK35_13885) | 2945286..2947097 | - | 1812 | WP_003414596.1 | penicillin-binding protein | - |
PAK35_RS13890 (PAK35_13890) | 2947369..2947650 | + | 282 | WP_003414599.1 | type II toxin-antitoxin system antitoxin RelF | Antitoxin |
PAK35_RS13895 (PAK35_13895) | 2947654..2947917 | + | 264 | WP_003414602.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PAK35_RS13900 (PAK35_13900) | 2948290..2949144 | - | 855 | WP_003899516.1 | GNAT family N-acetyltransferase | - |
PAK35_RS13905 (PAK35_13905) | 2949200..2950363 | - | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
PAK35_RS13910 (PAK35_13910) | 2950380..2951594 | - | 1215 | WP_003414610.1 | zinc metalloprotease Rip | - |
PAK35_RS13915 (PAK35_13915) | 2951602..2952843 | - | 1242 | WP_003414613.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10204.82 Da Isoelectric Point: 11.5078
>T267129 WP_003414602.1 NZ_CP115447:2947654-2947917 [Mycobacterium tuberculosis]
VPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDH
RADIYRR
VPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDH
RADIYRR
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|