267128

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN_Sll0205-like-Phd
Location 2906452..2907056 Replicon chromosome
Accession NZ_CP115447
Organism Mycobacterium tuberculosis strain BLR 9248 2019

Toxin (Protein)


Gene name vapC Uniprot ID P71623
Locus tag PAK35_RS13695 Protein ID WP_003414492.1
Coordinates 2906452..2906844 (-) Length 131 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A829CBY8
Locus tag PAK35_RS13700 Protein ID WP_003414495.1
Coordinates 2906841..2907056 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PAK35_RS13665 (PAK35_13665) 2901602..2902390 - 789 WP_003917092.1 CRISPR-associated endoribonuclease Cas6 -
PAK35_RS13670 (PAK35_13670) 2902724..2903269 - 546 WP_014584866.1 DUF1802 family protein -
PAK35_RS13675 (PAK35_13675) 2903541..2904425 - 885 WP_003414409.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
PAK35_RS13680 (PAK35_13680) 2904428..2905315 - 888 WP_003414414.1 type IV toxin-antitoxin system AbiEi family antitoxin -
PAK35_RS13685 (PAK35_13685) 2905620..2906165 - 546 WP_003910939.1 DUF1802 family protein -
PAK35_RS13690 (PAK35_13690) 2906162..2906431 - 270 WP_003414489.1 DUF2277 family protein -
PAK35_RS13695 (PAK35_13695) 2906452..2906844 - 393 WP_003414492.1 type II toxin-antitoxin system VapC family toxin Toxin
PAK35_RS13700 (PAK35_13700) 2906841..2907056 - 216 WP_003414495.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PAK35_RS13705 (PAK35_13705) 2907103..2907852 + 750 WP_003902358.1 enoyl-CoA hydratase -
PAK35_RS13710 (PAK35_13710) 2907931..2909013 - 1083 WP_003414499.1 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC -
PAK35_RS13715 (PAK35_13715) 2909006..2910316 - 1311 WP_003414501.1 ABC transporter substrate-binding protein -
PAK35_RS13720 (PAK35_13720) 2910319..2911146 - 828 WP_003414504.1 carbohydrate ABC transporter permease -
PAK35_RS13725 (PAK35_13725) 2911143..2912054 - 912 WP_003414505.1 sugar ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

VapC-like Sll0205 protein, PIN domain

(5-130)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(2-46)


Sequences

Toxin        


Download         Length: 131 a.a.        Molecular weight: 14610.74 Da        Isoelectric Point: 6.7594

>T267128 WP_003414492.1 NZ_CP115447:c2906844-2906452 [Mycobacterium tuberculosis]
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSV
AATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW

Download         Length: 393 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7511.55 Da        Isoelectric Point: 4.9732

>AT267128 WP_003414495.1 NZ_CP115447:c2907056-2906841 [Mycobacterium tuberculosis]
MTATEVKAKILSLLDEVAQGEEIEITKHGRTVARLVAATGPHALKGRFSGVAMAAVDDDELFTTGVSWNVS

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BWM8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CBY8

References