Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2886254..2886824 | Replicon | chromosome |
Accession | NZ_CP115447 | ||
Organism | Mycobacterium tuberculosis strain BLR 9248 2019 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | P71650 |
Locus tag | PAK35_RS13570 | Protein ID | WP_003414166.1 |
Coordinates | 2886254..2886610 (-) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | P0CL61 |
Locus tag | PAK35_RS13575 | Protein ID | WP_003901465.1 |
Coordinates | 2886594..2886824 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAK35_RS13550 (PAK35_13550) | 2881706..2883394 | - | 1689 | WP_003414155.1 | alpha/beta hydrolase family protein | - |
PAK35_RS13555 (PAK35_13555) | 2883398..2883724 | - | 327 | WP_003414157.1 | hypothetical protein | - |
PAK35_RS13560 (PAK35_13560) | 2883897..2884484 | + | 588 | WP_003914429.1 | DUF3558 family protein | - |
PAK35_RS13565 (PAK35_13565) | 2884503..2886152 | + | 1650 | Protein_2683 | CocE/NonD family hydrolase | - |
PAK35_RS13570 (PAK35_13570) | 2886254..2886610 | - | 357 | WP_003414166.1 | type II toxin-antitoxin system toxin endoribonuclease MazF9 | Toxin |
PAK35_RS13575 (PAK35_13575) | 2886594..2886824 | - | 231 | WP_003901465.1 | type II toxin-antitoxin system antitoxin MazE9 | Antitoxin |
PAK35_RS13580 (PAK35_13580) | 2886867..2887910 | - | 1044 | WP_003414172.1 | DUF2293 domain-containing protein | - |
PAK35_RS13585 (PAK35_13585) | 2887909..2888376 | + | 468 | WP_003414177.1 | DUF1778 domain-containing protein | - |
PAK35_RS13590 (PAK35_13590) | 2888552..2888806 | - | 255 | WP_003917684.1 | hypothetical protein | - |
PAK35_RS13595 (PAK35_13595) | 2888954..2889358 | + | 405 | WP_003414181.1 | hypothetical protein | - |
PAK35_RS13600 (PAK35_13600) | 2889355..2889546 | + | 192 | WP_003414184.1 | hypothetical protein | - |
PAK35_RS13605 (PAK35_13605) | 2889763..2890023 | + | 261 | Protein_2691 | transposase | - |
PAK35_RS13610 (PAK35_13610) | 2891133..2891390 | + | 258 | WP_003899489.1 | hypothetical protein | - |
PAK35_RS13615 (PAK35_13615) | 2891495..2891806 | + | 312 | WP_003414190.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 12858.73 Da Isoelectric Point: 9.1962
>T267126 WP_003414166.1 NZ_CP115447:c2886610-2886254 [Mycobacterium tuberculosis]
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|