Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 2846670..2847357 Replicon chromosome
Accession NZ_CP115447
Organism Mycobacterium tuberculosis strain BLR 9248 2019

Toxin (Protein)


Gene name vapC Uniprot ID G0TF65
Locus tag PAK35_RS13350 Protein ID WP_003414064.1
Coordinates 2846962..2847357 (-) Length 132 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TF64
Locus tag PAK35_RS13345 Protein ID WP_003414061.1
Coordinates 2846670..2846936 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PAK35_RS13315 (PAK35_13315) 2842309..2843211 - 903 WP_003900564.1 4-hydroxy-tetrahydrodipicolinate synthase -
PAK35_RS13320 (PAK35_13320) 2843280..2844032 - 753 WP_003899465.1 FAD-dependent thymidylate synthase -
PAK35_RS13325 (PAK35_13325) 2844276..2844551 - 276 WP_003414055.1 type I restriction endonuclease subunit S -
PAK35_RS13330 (PAK35_13330) 2844548..2846170 - 1623 WP_003414057.1 class I SAM-dependent DNA methyltransferase -
PAK35_RS13335 (PAK35_13335) 2846055..2846303 + 249 WP_172643166.1 hypothetical protein -
PAK35_RS13340 (PAK35_13340) 2846257..2846673 - 417 Protein_2638 type II toxin-antitoxin system toxin ribonuclease C21 -
PAK35_RS13345 (PAK35_13345) 2846670..2846936 - 267 WP_003414061.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PAK35_RS13350 (PAK35_13350) 2846962..2847357 - 396 WP_003414064.1 type II toxin-antitoxin system VapC family toxin Toxin
PAK35_RS13355 (PAK35_13355) 2847354..2847623 - 270 WP_003414066.1 type II toxin-antitoxin system VapB family antitoxin -
PAK35_RS13360 (PAK35_13360) 2847633..2848727 - 1095 WP_003414068.1 restriction endonuclease subunit S -
PAK35_RS13365 (PAK35_13365) 2848724..2849143 - 420 WP_003414070.1 winged helix-turn-helix domain-containing protein -
PAK35_RS13370 (PAK35_13370) 2849142..2849216 + 75 Protein_2644 hypothetical protein -
PAK35_RS13375 (PAK35_13375) 2849217..2849696 - 480 WP_003414073.1 dihydrofolate reductase -
PAK35_RS13380 (PAK35_13380) 2849767..2850567 - 801 WP_003911953.1 thymidylate synthase -
PAK35_RS13385 (PAK35_13385) 2850723..2851460 + 738 WP_003414079.1 dienelactone hydrolase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(1-125)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(16-56)


Sequences

Toxin        


Download         Length: 132 a.a.        Molecular weight: 14340.04 Da        Isoelectric Point: 4.7145

>T267125 WP_003414064.1 NZ_CP115447:c2847357-2846962 [Mycobacterium tuberculosis]
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT

Download         Length: 396 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9493.77 Da        Isoelectric Point: 7.2783

>AT267125 WP_003414061.1 NZ_CP115447:c2846936-2846670 [Mycobacterium tuberculosis]
MHRGYALVVCSPGVTRTMIDIDDDLLARAAKELGTTTKKDTVHAALRAALRASAARSLMNRMAENATGTQDEALVNAMWR
DGHPENTA

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TF65

Antitoxin

Source ID Structure
AlphaFold DB G0TF64

References