Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2705907..2706621 Replicon chromosome
Accession NZ_CP115447
Organism Mycobacterium tuberculosis strain BLR 9248 2019

Toxin (Protein)


Gene name vapC Uniprot ID G0TQK0
Locus tag PAK35_RS12510 Protein ID WP_003413460.1
Coordinates 2706181..2706621 (+) Length 147 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P9WJ20
Locus tag PAK35_RS12505 Protein ID WP_003413456.1
Coordinates 2705907..2706194 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PAK35_RS12470 (PAK35_12470) 2701329..2701574 + 246 WP_003413429.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
PAK35_RS12475 (PAK35_12475) 2701571..2701975 + 405 WP_003413432.1 type II toxin-antitoxin system VapC family toxin -
PAK35_RS12480 (PAK35_12480) 2702192..2702812 + 621 WP_003413441.1 DUF4178 domain-containing protein -
PAK35_RS12485 (PAK35_12485) 2702823..2703317 + 495 WP_003413444.1 DUF2617 family protein -
PAK35_RS12490 (PAK35_12490) 2703314..2703745 + 432 WP_003899390.1 DUF4247 domain-containing protein -
PAK35_RS12495 (PAK35_12495) 2703770..2704228 + 459 WP_003413451.1 DUF350 domain-containing protein -
PAK35_RS12500 (PAK35_12500) 2704225..2705796 + 1572 WP_003899392.1 polyamine aminopropyltransferase -
PAK35_RS12505 (PAK35_12505) 2705907..2706194 + 288 WP_003413456.1 antitoxin VapB41 Antitoxin
PAK35_RS12510 (PAK35_12510) 2706181..2706621 + 441 WP_003413460.1 type II toxin-antitoxin system VapC family toxin Toxin
PAK35_RS12515 (PAK35_12515) 2706642..2707397 - 756 WP_003413464.1 YebC/PmpR family DNA-binding transcriptional regulator -
PAK35_RS12520 (PAK35_12520) 2707530..2708126 - 597 WP_003413465.1 pyridoxal 5'-phosphate synthase glutaminase subunit PdxT -
PAK35_RS12525 (PAK35_12525) 2708134..2708979 - 846 WP_003413466.1 acyl-CoA thioesterase II -
PAK35_RS12530 (PAK35_12530) 2709008..2709907 - 900 WP_003413468.1 pyridoxal 5'-phosphate synthase lyase subunit PdxS -
PAK35_RS12535 (PAK35_12535) 2710035..2710709 + 675 WP_003413471.1 pyridoxamine 5'-phosphate oxidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-146)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 147 a.a.        Molecular weight: 16026.38 Da        Isoelectric Point: 6.8599

>T267123 WP_003413460.1 NZ_CP115447:2706181-2706621 [Mycobacterium tuberculosis]
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK

Download         Length: 441 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10453.98 Da        Isoelectric Point: 7.2797

>AT267123 WP_003413456.1 NZ_CP115447:2705907-2706194 [Mycobacterium tuberculosis]
MKTTLDLPDELMRAIKVRAAQQGRKMKDVVTELLRSGLSQTHSGAPIPTPRRVQLPLVHCGGAATREQEMTPERVAAALL
DQEAQWWSGHDDAAL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQK0

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BWB8

References