Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2645565..2646202 | Replicon | chromosome |
Accession | NZ_CP115447 | ||
Organism | Mycobacterium tuberculosis strain BLR 9248 2019 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P0DMV7 |
Locus tag | PAK35_RS12245 | Protein ID | WP_003413180.1 |
Coordinates | 2645565..2645960 (-) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ44 |
Locus tag | PAK35_RS12250 | Protein ID | WP_003413183.1 |
Coordinates | 2645957..2646202 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAK35_RS12205 (PAK35_12205) | 2640969..2642180 | + | 1212 | WP_003900845.1 | alpha/beta hydrolase family protein | - |
PAK35_RS12210 (PAK35_12210) | 2642307..2642966 | + | 660 | WP_003902296.1 | LppA family lipoprotein | - |
PAK35_RS12215 (PAK35_12215) | 2642963..2643625 | + | 663 | WP_003905878.1 | LppA family lipoprotein | - |
PAK35_RS12220 (PAK35_12220) | 2643622..2643899 | + | 278 | Protein_2418 | type II toxin-antitoxin system VapB family antitoxin | - |
PAK35_RS12225 (PAK35_12225) | 2643992..2644405 | + | 414 | WP_003413164.1 | PIN domain nuclease | - |
PAK35_RS12230 (PAK35_12230) | 2644444..2644701 | + | 258 | WP_003413167.1 | CopG family transcriptional regulator | - |
PAK35_RS12235 (PAK35_12235) | 2644698..2645075 | + | 378 | WP_003413174.1 | type II toxin-antitoxin system VapC family toxin | - |
PAK35_RS12240 (PAK35_12240) | 2645091..2645465 | - | 375 | WP_003413177.1 | hypothetical protein | - |
PAK35_RS12245 (PAK35_12245) | 2645565..2645960 | - | 396 | WP_003413180.1 | type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 | Toxin |
PAK35_RS12250 (PAK35_12250) | 2645957..2646202 | - | 246 | WP_003413183.1 | type II toxin-antitoxin system antitoxin VapB20 | Antitoxin |
PAK35_RS12255 (PAK35_12255) | 2646613..2647032 | - | 420 | WP_003413190.1 | A24 family peptidase | - |
PAK35_RS12260 (PAK35_12260) | 2647044..2647853 | - | 810 | WP_003413193.1 | shikimate dehydrogenase | - |
PAK35_RS12265 (PAK35_12265) | 2647850..2649103 | - | 1254 | WP_003413196.1 | endolytic transglycosylase MltG | - |
PAK35_RS12270 (PAK35_12270) | 2649096..2649608 | - | 513 | WP_003413197.1 | Holliday junction resolvase RuvX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14619.53 Da Isoelectric Point: 6.9794
>T267122 WP_003413180.1 NZ_CP115447:c2645960-2645565 [Mycobacterium tuberculosis]
MIFVDTSFWAALGNAGDARHGTAKRLWASKPPVVMTSNHVLGETWTLLNRRCGHRAAVAAAAIRLSTVVRVEHVTADLEE
QAWEWLVRHDEREYSFVDATSFAVMRKKGIQNAYAFDGDFSAAGFVEVRPE
MIFVDTSFWAALGNAGDARHGTAKRLWASKPPVVMTSNHVLGETWTLLNRRCGHRAAVAAAAIRLSTVVRVEHVTADLEE
QAWEWLVRHDEREYSFVDATSFAVMRKKGIQNAYAFDGDFSAAGFVEVRPE
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 5WZ4 | |
PDB | 5WZF |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BW31 |