Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC(toxin)
Location 2643992..2644701 Replicon chromosome
Accession NZ_CP115447
Organism Mycobacterium tuberculosis strain BLR 9248 2019

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ26
Locus tag PAK35_RS12225 Protein ID WP_003413164.1
Coordinates 2643992..2644405 (+) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P95006
Locus tag PAK35_RS12230 Protein ID WP_003413167.1
Coordinates 2644444..2644701 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PAK35_RS12195 (PAK35_12195) 2639046..2640251 - 1206 WP_003413027.1 chorismate synthase -
PAK35_RS12200 (PAK35_12200) 2640359..2640673 + 315 WP_009937839.1 hypothetical protein -
PAK35_RS12205 (PAK35_12205) 2640969..2642180 + 1212 WP_003900845.1 alpha/beta hydrolase family protein -
PAK35_RS12210 (PAK35_12210) 2642307..2642966 + 660 WP_003902296.1 LppA family lipoprotein -
PAK35_RS12215 (PAK35_12215) 2642963..2643625 + 663 WP_003905878.1 LppA family lipoprotein -
PAK35_RS12220 (PAK35_12220) 2643622..2643899 + 278 Protein_2418 type II toxin-antitoxin system VapB family antitoxin -
PAK35_RS12225 (PAK35_12225) 2643992..2644405 + 414 WP_003413164.1 PIN domain nuclease Toxin
PAK35_RS12230 (PAK35_12230) 2644444..2644701 + 258 WP_003413167.1 CopG family transcriptional regulator Antitoxin
PAK35_RS12235 (PAK35_12235) 2644698..2645075 + 378 WP_003413174.1 type II toxin-antitoxin system VapC family toxin -
PAK35_RS12240 (PAK35_12240) 2645091..2645465 - 375 WP_003413177.1 hypothetical protein -
PAK35_RS12245 (PAK35_12245) 2645565..2645960 - 396 WP_003413180.1 type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 -
PAK35_RS12250 (PAK35_12250) 2645957..2646202 - 246 WP_003413183.1 type II toxin-antitoxin system antitoxin VapB20 -
PAK35_RS12255 (PAK35_12255) 2646613..2647032 - 420 WP_003413190.1 A24 family peptidase -
PAK35_RS12260 (PAK35_12260) 2647044..2647853 - 810 WP_003413193.1 shikimate dehydrogenase -
PAK35_RS12265 (PAK35_12265) 2647850..2649103 - 1254 WP_003413196.1 endolytic transglycosylase MltG -
PAK35_RS12270 (PAK35_12270) 2649096..2649608 - 513 WP_003413197.1 Holliday junction resolvase RuvX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-122)

Antitoxin

Ribbon-helix-helix protein, CopG

(2-38)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 15045.00 Da        Isoelectric Point: 5.4673

>T267120 WP_003413164.1 NZ_CP115447:2643992-2644405 [Mycobacterium tuberculosis]
MVFCVDTSAWHHAARPEVARRWLAALSADQIGICDHVRLEILYSANSATDYDALADELDGLARIPVGAETFTRACQVQRE
LAHVAGLHHRSVKIADLVIAAAAELSGTIVWHYDENYDRVAAITGQPTEWIVPRGTL

Download         Length: 414 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9453.63 Da        Isoelectric Point: 10.6555

>AT267120 WP_003413167.1 NZ_CP115447:2644444-2644701 [Mycobacterium tuberculosis]
MRTQVTLGKEELELLDRAAKASGASRSELIRRAIHRAYGTGSKQERLAALDHSRGSWRGRDFTGTEYVDAIRGDLNERLA
RLGLA

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ26

Antitoxin

Source ID Structure
AlphaFold DB A0A829C9W5

References