Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2630106..2630746 Replicon chromosome
Accession NZ_CP115447
Organism Mycobacterium tuberculosis strain BLR 9248 2019

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ08
Locus tag PAK35_RS12140 Protein ID WP_003412970.1
Coordinates 2630106..2630525 (-) Length 140 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ09
Locus tag PAK35_RS12145 Protein ID WP_003412975.1
Coordinates 2630522..2630746 (-) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PAK35_RS12110 (PAK35_12110) 2625696..2626418 - 723 WP_003412957.1 DUF1906 domain-containing protein -
PAK35_RS12115 (PAK35_12115) 2626935..2627157 + 223 Protein_2397 type II toxin-antitoxin system VapB family antitoxin -
PAK35_RS12120 (PAK35_12120) 2627154..2627555 + 402 WP_003412963.1 PIN domain-containing protein -
PAK35_RS12125 (PAK35_12125) 2627590..2628510 - 921 WP_003412965.1 restriction endonuclease -
PAK35_RS12130 (PAK35_12130) 2628851..2629096 - 246 WP_071854223.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
PAK35_RS12135 (PAK35_12135) 2629155..2630105 + 951 WP_003911916.1 ERCC4 domain-containing protein -
PAK35_RS12140 (PAK35_12140) 2630106..2630525 - 420 WP_003412970.1 type II toxin-antitoxin system VapC family toxin Toxin
PAK35_RS12145 (PAK35_12145) 2630522..2630746 - 225 WP_003412975.1 antitoxin VapB39 Antitoxin
PAK35_RS12150 (PAK35_12150) 2630777..2633620 - 2844 WP_003899363.1 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -
PAK35_RS12155 (PAK35_12155) 2633692..2634093 - 402 WP_003412981.1 hypothetical protein -
PAK35_RS12160 (PAK35_12160) 2634093..2634563 - 471 WP_003899364.1 transcription antitermination factor NusB -
PAK35_RS12165 (PAK35_12165) 2634566..2635129 - 564 WP_003412989.1 elongation factor P -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-128)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 140 a.a.        Molecular weight: 14732.70 Da        Isoelectric Point: 6.7519

>T267119 WP_003412970.1 NZ_CP115447:c2630525-2630106 [Mycobacterium tuberculosis]
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL

Download         Length: 420 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 7993.94 Da        Isoelectric Point: 4.0057

>AT267119 WP_003412975.1 NZ_CP115447:c2630746-2630522 [Mycobacterium tuberculosis]
MRTTLQIDDDVLEDARSIARSEGKSVGAVISELARRSLRPVGIVEVDGFPVFDVPPDAPTVTSEDVVRALEDDV

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ08

Antitoxin

Source ID Structure
AlphaFold DB G0TQ09

References