Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 2583927..2584579 | Replicon | chromosome |
| Accession | NZ_CP115447 | ||
| Organism | Mycobacterium tuberculosis strain BLR 9248 2019 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A5R1ZCY8 |
| Locus tag | PAK35_RS11945 | Protein ID | WP_003905869.1 |
| Coordinates | 2584154..2584579 (+) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ24 |
| Locus tag | PAK35_RS11940 | Protein ID | WP_003412749.1 |
| Coordinates | 2583927..2584148 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PAK35_RS11925 (PAK35_11925) | 2582167..2582373 | - | 207 | WP_003899347.1 | hypothetical protein | - |
| PAK35_RS11930 (PAK35_11930) | 2582509..2583132 | + | 624 | WP_003900858.1 | TIGR00725 family protein | - |
| PAK35_RS11935 (PAK35_11935) | 2583122..2583874 | + | 753 | WP_003901416.1 | hypothetical protein | - |
| PAK35_RS11940 (PAK35_11940) | 2583927..2584148 | + | 222 | WP_003412749.1 | antitoxin | Antitoxin |
| PAK35_RS11945 (PAK35_11945) | 2584154..2584579 | + | 426 | WP_003905869.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PAK35_RS11950 (PAK35_11950) | 2584602..2585783 | - | 1182 | WP_003905870.1 | dihydrolipoamide acetyltransferase family protein | - |
| PAK35_RS11955 (PAK35_11955) | 2585780..2586826 | - | 1047 | WP_003412757.1 | 3-methyl-2-oxobutanoate dehydrogenase subunit beta | - |
| PAK35_RS11960 (PAK35_11960) | 2586837..2587940 | - | 1104 | WP_003412761.1 | pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha | - |
| PAK35_RS11965 (PAK35_11965) | 2588199..2589020 | - | 822 | WP_003412766.1 | citrate (pro-3S)-lyase subunit beta | - |
| PAK35_RS11970 (PAK35_11970) | 2589017..2589574 | - | 558 | WP_003412768.1 | MaoC family dehydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15364.84 Da Isoelectric Point: 9.2386
>T267118 WP_003905869.1 NZ_CP115447:2584154-2584579 [Mycobacterium tuberculosis]
VALLDVNALVALAWDSHIHHARIREWFTANATLGWATCPLTEAGFVRASTNPKVLPSAIGIADARRVLVALRAVGGHRFL
ADDVSLVDDDVPLIVGYRQVTDAHLLTLARRRGVRLVTFDAGVFTLAQQRPKTPVELLTIL
VALLDVNALVALAWDSHIHHARIREWFTANATLGWATCPLTEAGFVRASTNPKVLPSAIGIADARRVLVALRAVGGHRFL
ADDVSLVDDDVPLIVGYRQVTDAHLLTLARRRGVRLVTFDAGVFTLAQQRPKTPVELLTIL
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5R1ZCY8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BW03 |