Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/-
Location 2181358..2181887 Replicon chromosome
Accession NZ_CP115447
Organism Mycobacterium tuberculosis strain BLR 9248 2019

Toxin (Protein)


Gene name parE Uniprot ID G0TMR4
Locus tag PAK35_RS10040 Protein ID WP_003411124.1
Coordinates 2181358..2181675 (-) Length 106 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P9WJ74
Locus tag PAK35_RS10045 Protein ID WP_003411127.1
Coordinates 2181672..2181887 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PAK35_RS10010 (PAK35_10010) 2176379..2177455 + 1077 WP_003411110.1 hypothetical protein -
PAK35_RS10015 (PAK35_10015) 2177452..2177733 + 282 WP_003411112.1 DUF5703 family protein -
PAK35_RS10020 (PAK35_10020) 2177769..2178842 + 1074 WP_003901338.1 quinone-dependent dihydroorotate dehydrogenase -
PAK35_RS10025 (PAK35_10025) 2178847..2179377 - 531 WP_003411119.1 YbhB/YbcL family Raf kinase inhibitor-like protein -
PAK35_RS10030 (PAK35_10030) 2179425..2180771 - 1347 WP_003411121.1 M20/M25/M40 family metallo-hydrolase -
PAK35_RS10040 (PAK35_10040) 2181358..2181675 - 318 WP_003411124.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PAK35_RS10045 (PAK35_10045) 2181672..2181887 - 216 WP_003411127.1 antitoxin ParD2 Antitoxin
PAK35_RS10050 (PAK35_10050) 2182142..2183200 + 1059 WP_003411129.1 phosphoribosyltransferase family protein -
PAK35_RS10055 (PAK35_10055) 2183330..2183686 - 357 WP_003411130.1 hypothetical protein -
PAK35_RS10060 (PAK35_10060) 2183781..2184563 - 783 WP_003411131.1 cell wall synthesis protein Wag31 -
PAK35_RS10065 (PAK35_10065) 2184831..2185121 - 291 WP_003900476.1 YggT family protein -
PAK35_RS10070 (PAK35_10070) 2185283..2185939 - 657 WP_003411133.1 cell division protein SepF -
PAK35_RS10075 (PAK35_10075) 2186001..2186780 - 780 WP_015575160.1 YggS family pyridoxal phosphate-dependent enzyme -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-92)

Antitoxin

Conserved hypothetical protein CHP02574, addiction module

(11-69)


Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12312.88 Da        Isoelectric Point: 6.4831

>T267117 WP_003411124.1 NZ_CP115447:c2181675-2181358 [Mycobacterium tuberculosis]
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAI
DILAVRHGMENPNAVEAEISGRTFE

Download         Length: 318 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7880.70 Da        Isoelectric Point: 4.4055

>AT267117 WP_003411127.1 NZ_CP115447:c2181887-2181672 [Mycobacterium tuberculosis]
VVVNRALLASVDALSRDEQIELVEHINGNLAEGMHISEANQALIEARANDTDDAHWSTIDDFDKRIRARLG

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TMR4

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4FAJ4

References