Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK(toxin) |
| Location | 2098388..2099024 | Replicon | chromosome |
| Accession | NZ_CP115447 | ||
| Organism | Mycobacterium tuberculosis strain BLR 9248 2019 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | P0CL62 |
| Locus tag | PAK35_RS09630 | Protein ID | WP_003410654.1 |
| Coordinates | 2098614..2099024 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | P9WJ84 |
| Locus tag | PAK35_RS09625 | Protein ID | WP_003410651.1 |
| Coordinates | 2098388..2098621 (+) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PAK35_RS09610 (PAK35_09610) | 2093836..2094237 | + | 402 | WP_009937711.1 | metal ABC transporter permease | - |
| PAK35_RS09615 (PAK35_09615) | 2094238..2094642 | - | 405 | WP_003410645.1 | PPOX class F420-dependent oxidoreductase | - |
| PAK35_RS09620 (PAK35_09620) | 2094726..2098310 | - | 3585 | WP_003910889.1 | cobaltochelatase subunit CobN | - |
| PAK35_RS09625 (PAK35_09625) | 2098388..2098621 | + | 234 | WP_003410651.1 | type II toxin-antitoxin system antitoxin MazE7 | Antitoxin |
| PAK35_RS09630 (PAK35_09630) | 2098614..2099024 | + | 411 | WP_003410654.1 | type II toxin-antitoxin system toxin endoribonuclease MazF7 | Toxin |
| PAK35_RS09635 (PAK35_09635) | 2099008..2100099 | + | 1092 | WP_003900454.1 | precorrin-3B synthase | - |
| PAK35_RS09640 (PAK35_09640) | 2100109..2100735 | + | 627 | WP_003410658.1 | precorrin-8X methylmutase | - |
| PAK35_RS09645 (PAK35_09645) | 2100732..2102258 | + | 1527 | WP_003410659.1 | precorrin-2 C(20)-methyltransferase | - |
| PAK35_RS09650 (PAK35_09650) | 2102204..2103427 | - | 1224 | WP_003901321.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 14235.42 Da Isoelectric Point: 10.6228
>T267115 WP_003410654.1 NZ_CP115447:2098614-2099024 [Mycobacterium tuberculosis]
MAEPRRGDLWLVSLGAARAGEPGKHRPAVVVSVDELLTGIDDELVVVVPVSSSRSRTPLRPPVAPSEGVAADSVAVCRGV
RAVARARLVERLGALKPATMRAIENALTLILGLPTGPERGEAATHSPVRWTGGRDP
MAEPRRGDLWLVSLGAARAGEPGKHRPAVVVSVDELLTGIDDELVVVVPVSSSRSRTPLRPPVAPSEGVAADSVAVCRGV
RAVARARLVERLGALKPATMRAIENALTLILGLPTGPERGEAATHSPVRWTGGRDP
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|