Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 2027887..2028513 | Replicon | chromosome |
Accession | NZ_CP115447 | ||
Organism | Mycobacterium tuberculosis strain BLR 9248 2019 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P64926 |
Locus tag | PAK35_RS09320 | Protein ID | WP_003410075.1 |
Coordinates | 2028115..2028513 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A806JLL8 |
Locus tag | PAK35_RS09315 | Protein ID | WP_003911750.1 |
Coordinates | 2027887..2028114 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAK35_RS09305 (PAK35_09305) | 2025926..2026270 | - | 345 | WP_003410065.1 | ferredoxin family protein | - |
PAK35_RS09310 (PAK35_09310) | 2026459..2027628 | - | 1170 | WP_003899126.1 | ATP-binding protein | - |
PAK35_RS09315 (PAK35_09315) | 2027887..2028114 | + | 228 | WP_003911750.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PAK35_RS09320 (PAK35_09320) | 2028115..2028513 | + | 399 | WP_003410075.1 | PIN domain nuclease | Toxin |
PAK35_RS09325 (PAK35_09325) | 2028696..2029127 | - | 432 | WP_003410078.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
PAK35_RS09330 (PAK35_09330) | 2029228..2029662 | + | 435 | WP_003914358.1 | DUF1398 domain-containing protein | - |
PAK35_RS09335 (PAK35_09335) | 2030099..2030278 | - | 180 | Protein_1851 | hypothetical protein | - |
PAK35_RS09340 (PAK35_09340) | 2030366..2030986 | + | 621 | WP_003410086.1 | IS110 family transposase | - |
PAK35_RS09345 (PAK35_09345) | 2030940..2031530 | + | 591 | WP_003899131.1 | IS110 family transposase | - |
PAK35_RS09350 (PAK35_09350) | 2031658..2032914 | - | 1257 | WP_003902247.1 | HNH endonuclease signature motif containing protein | - |
PAK35_RS09355 (PAK35_09355) | 2033268..2033468 | + | 201 | Protein_1855 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14731.02 Da Isoelectric Point: 6.7067
>T267113 WP_003410075.1 NZ_CP115447:2028115-2028513 [Mycobacterium tuberculosis]
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|