Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2004149..2004735 | Replicon | chromosome |
Accession | NZ_CP115447 | ||
Organism | Mycobacterium tuberculosis strain BLR 9248 2019 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G0TLY3 |
Locus tag | PAK35_RS09215 | Protein ID | WP_003410010.1 |
Coordinates | 2004149..2004493 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | P0CL58 |
Locus tag | PAK35_RS09220 | Protein ID | WP_003410014.1 |
Coordinates | 2004487..2004735 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAK35_RS09180 (PAK35_09180) | 1999855..2000454 | + | 600 | WP_003910883.1 | L-lysine exporter | - |
PAK35_RS09185 (PAK35_09185) | 2000870..2001298 | + | 429 | WP_003409992.1 | cellulose-binding protein | - |
PAK35_RS09190 (PAK35_09190) | 2001524..2002063 | + | 540 | WP_003900446.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(37) | - |
PAK35_RS09195 (PAK35_09195) | 2002583..2003143 | - | 561 | WP_003410001.1 | RES family NAD+ phosphorylase | - |
PAK35_RS09200 (PAK35_09200) | 2003140..2003481 | - | 342 | WP_003410003.1 | DUF2384 domain-containing protein | - |
PAK35_RS09205 (PAK35_09205) | 2003567..2003824 | + | 258 | WP_003410006.1 | hypothetical protein | - |
PAK35_RS09210 (PAK35_09210) | 2003725..2004060 | - | 336 | WP_003410009.1 | dehydrogenase | - |
PAK35_RS09215 (PAK35_09215) | 2004149..2004493 | - | 345 | WP_003410010.1 | type II toxin-antitoxin system toxin endoribonuclease MazF6 | Toxin |
PAK35_RS09220 (PAK35_09220) | 2004487..2004735 | - | 249 | WP_003410014.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
PAK35_RS09225 (PAK35_09225) | 2004835..2007150 | - | 2316 | WP_003899120.1 | cation transporter ATPase CptG | - |
PAK35_RS09230 (PAK35_09230) | 2007147..2007419 | - | 273 | WP_003410017.1 | DUF1490 family protein | - |
PAK35_RS09235 (PAK35_09235) | 2007472..2007828 | - | 357 | WP_003410018.1 | Cd(II)/Pb(II)-sensing metalloregulatory transcriptional regulator CmtR | - |
PAK35_RS09240 (PAK35_09240) | 2007985..2008751 | + | 767 | Protein_1832 | hemerythrin domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12230.12 Da Isoelectric Point: 9.8887
>T267112 WP_003410010.1 NZ_CP115447:c2004493-2004149 [Mycobacterium tuberculosis]
VVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTA
IVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
VVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTA
IVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|