Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 1970785..1971329 Replicon chromosome
Accession NZ_CP115447
Organism Mycobacterium tuberculosis strain BLR 9248 2019

Toxin (Protein)


Gene name parE Uniprot ID G0TLU9
Locus tag PAK35_RS09005 Protein ID WP_003409896.1
Coordinates 1970785..1971081 (-) Length 99 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P67299
Locus tag PAK35_RS09010 Protein ID WP_003409899.1
Coordinates 1971078..1971329 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PAK35_RS08950 (PAK35_08950) 1965818..1966168 - 351 WP_003409871.1 hypothetical protein -
PAK35_RS08955 (PAK35_08955) 1966179..1967081 - 903 WP_003899097.1 hypothetical protein -
PAK35_RS08960 (PAK35_08960) 1967102..1967293 - 192 WP_003409876.1 hypothetical protein -
PAK35_RS08965 (PAK35_08965) 1967294..1967590 - 297 WP_003409877.1 hypothetical protein -
PAK35_RS08970 (PAK35_08970) 1967830..1968045 + 216 WP_003409878.1 antitoxin -
PAK35_RS08975 (PAK35_08975) 1968042..1968353 + 312 WP_003409881.1 type II toxin-antitoxin system VapC family toxin -
PAK35_RS08980 (PAK35_08980) 1968327..1968848 - 522 WP_003904745.1 hypothetical protein -
PAK35_RS08985 (PAK35_08985) 1968823..1969200 + 378 WP_010886136.1 type II toxin-antitoxin system toxin HigB -
PAK35_RS08990 (PAK35_08990) 1969242..1969691 + 450 WP_003409886.1 type II toxin-antitoxin system antitoxin HigA -
PAK35_RS08995 (PAK35_08995) 1969688..1970233 + 546 WP_003409891.1 SecB-like chaperone -
PAK35_RS09000 (PAK35_09000) 1970122..1970736 - 615 WP_003901296.1 hypothetical protein -
PAK35_RS09005 (PAK35_09005) 1970785..1971081 - 297 WP_003409896.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PAK35_RS09010 (PAK35_09010) 1971078..1971329 - 252 WP_003409899.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
PAK35_RS09015 (PAK35_09015) 1971316..1971810 + 495 WP_003899099.1 hypothetical protein -
PAK35_RS09020 (PAK35_09020) 1971970..1972377 - 408 WP_003409913.1 type II toxin-antitoxin system VapC family toxin -
PAK35_RS09025 (PAK35_09025) 1972381..1972653 - 273 WP_003899100.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
PAK35_RS09030 (PAK35_09030) 1972686..1973906 - 1221 WP_003409919.1 TetR family transcriptional regulator Mce3R -
PAK35_RS09035 (PAK35_09035) 1974805..1975602 + 798 WP_003899101.1 ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-93)

Antitoxin

Antitoxin ParD

(2-80)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11268.64 Da        Isoelectric Point: 6.8604

>T267109 WP_003409896.1 NZ_CP115447:c1971081-1970785 [Mycobacterium tuberculosis]
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEG
TIDVVRVLHQRMDVDRNL

Download         Length: 297 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9207.17 Da        Isoelectric Point: 7.0150

>AT267109 WP_003409899.1 NZ_CP115447:c1971329-1971078 [Mycobacterium tuberculosis]
VGKNTSFVLDEHYSAFIDGEIAAGRYRSASEVIRSALRLLEDRETQLRALREALEAGERSGSSTPFDFDGFLGRKRADAS
RGR

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TLU9

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BUZ2

References