Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1961748..1962451 | Replicon | chromosome |
Accession | NZ_CP115447 | ||
Organism | Mycobacterium tuberculosis strain BLR 9248 2019 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G0TLK7 |
Locus tag | PAK35_RS08915 | Protein ID | WP_003409778.1 |
Coordinates | 1961748..1962077 (-) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TLK8 |
Locus tag | PAK35_RS08920 | Protein ID | WP_003409780.1 |
Coordinates | 1962074..1962451 (-) | Length | 126 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAK35_RS08895 (PAK35_08895) | 1958131..1959201 | + | 1071 | WP_003902252.1 | epoxide hydrolase EphB | - |
PAK35_RS08900 (PAK35_08900) | 1959198..1959713 | + | 516 | WP_003409718.1 | flavin reductase family protein | - |
PAK35_RS08905 (PAK35_08905) | 1959710..1960771 | + | 1062 | WP_003899092.1 | 3,4-dihydroxy-2-butanone-4-phosphate synthase | - |
PAK35_RS08910 (PAK35_08910) | 1960768..1961538 | + | 771 | WP_003409775.1 | SDR family oxidoreductase | - |
PAK35_RS08915 (PAK35_08915) | 1961748..1962077 | - | 330 | WP_003409778.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PAK35_RS08920 (PAK35_08920) | 1962074..1962451 | - | 378 | WP_003409780.1 | type II toxin-antitoxin system antitoxin MazE5 | Antitoxin |
PAK35_RS08925 (PAK35_08925) | 1962448..1963038 | - | 591 | WP_003409784.1 | SEC-C metal-binding domain-containing protein | - |
PAK35_RS08930 (PAK35_08930) | 1963093..1964457 | + | 1365 | WP_003910878.1 | HNH endonuclease signature motif containing protein | - |
PAK35_RS08935 (PAK35_08935) | 1964612..1965064 | - | 453 | WP_003899095.1 | lipoprotein | - |
PAK35_RS08940 (PAK35_08940) | 1965128..1965529 | + | 402 | WP_003409869.1 | hypothetical protein | - |
PAK35_RS08945 (PAK35_08945) | 1965522..1965704 | - | 183 | WP_003409870.1 | hypothetical protein | - |
PAK35_RS08950 (PAK35_08950) | 1965818..1966168 | - | 351 | WP_003409871.1 | hypothetical protein | - |
PAK35_RS08955 (PAK35_08955) | 1966179..1967081 | - | 903 | WP_003899097.1 | hypothetical protein | - |
PAK35_RS08960 (PAK35_08960) | 1967102..1967293 | - | 192 | WP_003409876.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 11787.82 Da Isoelectric Point: 8.5361
>T267107 WP_003409778.1 NZ_CP115447:c1962077-1961748 [Mycobacterium tuberculosis]
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
Download Length: 330 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13560.07 Da Isoelectric Point: 5.1519
>AT267107 WP_003409780.1 NZ_CP115447:c1962451-1962074 [Mycobacterium tuberculosis]
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|