Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 1721668..1722281 | Replicon | chromosome |
Accession | NZ_CP115447 | ||
Organism | Mycobacterium tuberculosis strain BLR 9248 2019 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PAK35_RS07835 | Protein ID | WP_003910864.1 |
Coordinates | 1721668..1722057 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ52 |
Locus tag | PAK35_RS07840 | Protein ID | WP_003408469.1 |
Coordinates | 1722054..1722281 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAK35_RS07800 (PAK35_07800) | 1717297..1718211 | + | 915 | WP_003898985.1 | 3-hydroxyacyl-CoA dehydrogenase family protein | - |
PAK35_RS07805 (PAK35_07805) | 1718214..1719044 | + | 831 | WP_003408448.1 | cyclase family protein | - |
PAK35_RS07810 (PAK35_07810) | 1719044..1719394 | + | 351 | WP_003898986.1 | cupin domain-containing protein | - |
PAK35_RS07815 (PAK35_07815) | 1719447..1720265 | + | 819 | WP_003408456.1 | 3-keto-5-aminohexanoate cleavage protein | - |
PAK35_RS07820 (PAK35_07820) | 1720279..1721058 | + | 780 | WP_003408460.1 | IclR family transcriptional regulator | - |
PAK35_RS07830 (PAK35_07830) | 1721489..1721620 | + | 132 | Protein_1550 | IS3 family transposase | - |
PAK35_RS07835 (PAK35_07835) | 1721668..1722057 | - | 390 | WP_003910864.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PAK35_RS07840 (PAK35_07840) | 1722054..1722281 | - | 228 | WP_003408469.1 | antitoxin | Antitoxin |
PAK35_RS07845 (PAK35_07845) | 1722499..1723983 | + | 1485 | WP_003408473.1 | biotin carboxylase | - |
PAK35_RS07850 (PAK35_07850) | 1723980..1725227 | + | 1248 | WP_003408476.1 | serine hydrolase | - |
PAK35_RS07855 (PAK35_07855) | 1725270..1725689 | - | 420 | WP_003408483.1 | hypothetical protein | - |
PAK35_RS07860 (PAK35_07860) | 1725679..1726389 | - | 711 | WP_003408486.1 | winged helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 13837.02 Da Isoelectric Point: 7.4232
>T267105 WP_003910864.1 NZ_CP115447:c1722057-1721668 [Mycobacterium tuberculosis]
VIVLDASAAVELMLTTPAGAAVARRLRGETVRAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFT
QRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA
VIVLDASAAVELMLTTPAGAAVARRLRGETVRAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFT
QRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|