Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 1547266..1547879 | Replicon | chromosome |
Accession | NZ_CP115447 | ||
Organism | Mycobacterium tuberculosis strain BLR 9248 2019 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P64880 |
Locus tag | PAK35_RS07080 | Protein ID | WP_003407786.1 |
Coordinates | 1547475..1547879 (+) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A0E8UJ46 |
Locus tag | PAK35_RS07075 | Protein ID | WP_009935474.1 |
Coordinates | 1547266..1547469 (+) | Length | 68 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAK35_RS07045 (PAK35_07045) | 1542671..1543051 | + | 381 | WP_003407768.1 | fumarate reductase subunit C | - |
PAK35_RS07050 (PAK35_07050) | 1543048..1543425 | + | 378 | WP_003407771.1 | fumarate reductase subunit FrdD | - |
PAK35_RS07055 (PAK35_07055) | 1543493..1544101 | + | 609 | WP_003407773.1 | TetR/AcrR family transcriptional regulator | - |
PAK35_RS07060 (PAK35_07060) | 1544285..1545433 | + | 1149 | Protein_1398 | MMPL family transporter | - |
PAK35_RS07065 (PAK35_07065) | 1545443..1545889 | + | 447 | WP_003407780.1 | F420H(2)-dependent quinone reductase | - |
PAK35_RS07070 (PAK35_07070) | 1545924..1547213 | + | 1290 | WP_003407781.1 | threonine ammonia-lyase | - |
PAK35_RS07075 (PAK35_07075) | 1547266..1547469 | + | 204 | WP_009935474.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PAK35_RS07080 (PAK35_07080) | 1547475..1547879 | + | 405 | WP_003407786.1 | type II toxin-antitoxin system toxin ribonuclease VapC11 | Toxin |
PAK35_RS07085 (PAK35_07085) | 1547896..1549638 | - | 1743 | WP_003407788.1 | malto-oligosyltrehalose trehalohydrolase | - |
PAK35_RS07090 (PAK35_07090) | 1549631..1551928 | - | 2298 | WP_003407790.1 | malto-oligosyltrehalose synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14650.76 Da Isoelectric Point: 5.6587
>T267104 WP_003407786.1 NZ_CP115447:1547475-1547879 [Mycobacterium tuberculosis]
MILIDTSAWVEYFRATGSIAAVEVRRLLSEEAARIAMCEPIAMEILSGALDDNTHTTLERLVNGLPSLNVDDAIDFRAAA
GIYRAARRAGETVRSINDCLIAALAIRHGARIVHRDADFDVIARITNLQAASFR
MILIDTSAWVEYFRATGSIAAVEVRRLLSEEAARIAMCEPIAMEILSGALDDNTHTTLERLVNGLPSLNVDDAIDFRAAA
GIYRAARRAGETVRSINDCLIAALAIRHGARIVHRDADFDVIARITNLQAASFR
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|