Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1468768..1469384 | Replicon | chromosome |
Accession | NZ_CP115447 | ||
Organism | Mycobacterium tuberculosis strain BLR 9248 2019 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G0TJ74 |
Locus tag | PAK35_RS06735 | Protein ID | WP_003407593.1 |
Coordinates | 1469067..1469384 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TJ73 |
Locus tag | PAK35_RS06730 | Protein ID | WP_003900349.1 |
Coordinates | 1468768..1469070 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAK35_RS06720 (PAK35_06720) | 1464654..1466501 | + | 1848 | WP_003407585.1 | methylmalonyl-CoA mutase small subunit | - |
PAK35_RS06725 (PAK35_06725) | 1466502..1468754 | + | 2253 | WP_003407587.1 | methylmalonyl-CoA mutase | - |
PAK35_RS06730 (PAK35_06730) | 1468768..1469070 | + | 303 | WP_003900349.1 | type II toxin-antitoxin system antitoxin MazE4 | Antitoxin |
PAK35_RS06735 (PAK35_06735) | 1469067..1469384 | + | 318 | WP_003407593.1 | type II toxin-antitoxin system toxin endoribonuclease MazF4 | Toxin |
PAK35_RS06740 (PAK35_06740) | 1469381..1470385 | + | 1005 | WP_003407596.1 | methylmalonyl Co-A mutase-associated GTPase MeaB | - |
PAK35_RS06745 (PAK35_06745) | 1470438..1471727 | + | 1290 | WP_003902090.1 | serine hydrolase domain-containing protein | - |
PAK35_RS06750 (PAK35_06750) | 1471800..1472525 | - | 726 | WP_003898898.1 | class I SAM-dependent methyltransferase | - |
PAK35_RS06755 (PAK35_06755) | 1472631..1472843 | - | 213 | WP_003898900.1 | dodecin family protein | - |
PAK35_RS06760 (PAK35_06760) | 1472904..1473302 | + | 399 | WP_003900351.1 | hypothetical protein | - |
PAK35_RS06765 (PAK35_06765) | 1473347..1474375 | + | 1029 | WP_003407612.1 | glycosyltransferase family 2 protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11377.97 Da Isoelectric Point: 7.9950
>T267103 WP_003407593.1 NZ_CP115447:1469067-1469384 [Mycobacterium tuberculosis]
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|