Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 1354805..1355460 | Replicon | chromosome |
Accession | NZ_CP115447 | ||
Organism | Mycobacterium tuberculosis strain BLR 9248 2019 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WFA6 |
Locus tag | PAK35_RS06230 | Protein ID | WP_003898861.1 |
Coordinates | 1354805..1355206 (-) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TIK2 |
Locus tag | PAK35_RS06235 | Protein ID | WP_003407272.1 |
Coordinates | 1355203..1355460 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAK35_RS06215 (PAK35_06215) | 1350277..1351662 | - | 1386 | WP_003407260.1 | cytochrome P450 | - |
PAK35_RS06220 (PAK35_06220) | 1351740..1352774 | + | 1035 | WP_003407264.1 | AraC family transcriptional regulator | - |
PAK35_RS06225 (PAK35_06225) | 1352820..1354550 | - | 1731 | WP_009940170.1 | PE family protein | - |
PAK35_RS06230 (PAK35_06230) | 1354805..1355206 | - | 402 | WP_003898861.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PAK35_RS06235 (PAK35_06235) | 1355203..1355460 | - | 258 | WP_003407272.1 | CopG family transcriptional regulator | Antitoxin |
PAK35_RS06240 (PAK35_06240) | 1355543..1356502 | - | 960 | WP_003407276.1 | alpha/beta hydrolase | - |
PAK35_RS06245 (PAK35_06245) | 1356527..1357489 | - | 963 | WP_003905554.1 | alpha/beta hydrolase | - |
PAK35_RS06250 (PAK35_06250) | 1357488..1358225 | + | 738 | WP_031647000.1 | lysoplasmalogenase | - |
PAK35_RS06255 (PAK35_06255) | 1358306..1360273 | + | 1968 | WP_003407285.1 | primosomal protein N' | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14952.43 Da Isoelectric Point: 11.4656
>T267102 WP_003898861.1 NZ_CP115447:c1355206-1354805 [Mycobacterium tuberculosis]
MILVDSDVLIAHLRGVVAARDWLVSARKDGPLAISVVSTAELIGGMRTAERREVWRLLASFRVQPATEVIARRAGDMMRR
YRRSHNRIGLGDYLIAATADVQDLQLATLNVWHFPMFEQLKPPFAVPGHRPRA
MILVDSDVLIAHLRGVVAARDWLVSARKDGPLAISVVSTAELIGGMRTAERREVWRLLASFRVQPATEVIARRAGDMMRR
YRRSHNRIGLGDYLIAATADVQDLQLATLNVWHFPMFEQLKPPFAVPGHRPRA
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A045ISB0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TIK2 |