Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 1167794..1168353 | Replicon | chromosome |
Accession | NZ_CP115447 | ||
Organism | Mycobacterium tuberculosis strain BLR 9248 2019 |
Toxin (Protein)
Gene name | relE | Uniprot ID | G0THS1 |
Locus tag | PAK35_RS05415 | Protein ID | WP_003898789.1 |
Coordinates | 1167794..1168087 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | G0THS2 |
Locus tag | PAK35_RS05420 | Protein ID | WP_003406322.1 |
Coordinates | 1168084..1168353 (-) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAK35_RS05390 (PAK35_05390) | 1163492..1163752 | + | 261 | WP_003406302.1 | type II toxin-antitoxin system antitoxin VapB33 | - |
PAK35_RS05395 (PAK35_05395) | 1163749..1164180 | + | 432 | WP_003406304.1 | type II toxin-antitoxin system VapC family toxin | - |
PAK35_RS05400 (PAK35_05400) | 1164203..1165786 | - | 1584 | WP_271095676.1 | PE family protein | - |
PAK35_RS05405 (PAK35_05405) | 1165966..1166826 | + | 861 | WP_003900301.1 | glycine betaine ABC transporter substrate-binding protein | - |
PAK35_RS05410 (PAK35_05410) | 1166907..1167737 | - | 831 | WP_003898788.1 | SDR family NAD(P)-dependent oxidoreductase | - |
PAK35_RS05415 (PAK35_05415) | 1167794..1168087 | - | 294 | WP_003898789.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
PAK35_RS05420 (PAK35_05420) | 1168084..1168353 | - | 270 | WP_003406322.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PAK35_RS05425 (PAK35_05425) | 1168466..1172161 | - | 3696 | WP_003406323.1 | multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit | - |
PAK35_RS05430 (PAK35_05430) | 1172303..1173091 | - | 789 | WP_003406325.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11031.57 Da Isoelectric Point: 9.6275
>T267100 WP_003898789.1 NZ_CP115447:c1168087-1167794 [Mycobacterium tuberculosis]
VSDDHPYHVAITATAARDLQRLPEKIAAACVEFVFGPLLNNPHRLGKPLRNDLEGLHSARRGDYRVVYAIDDGHHRVEII
HIARRSASYRMNPCRPR
VSDDHPYHVAITATAARDLQRLPEKIAAACVEFVFGPLLNNPHRLGKPLRNDLEGLHSARRGDYRVVYAIDDGHHRVEII
HIARRSASYRMNPCRPR
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|