Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 708998..709672 Replicon chromosome
Accession NZ_CP115447
Organism Mycobacterium tuberculosis strain BLR 9248 2019

Toxin (Protein)


Gene name vapC Uniprot ID P9WF52
Locus tag PAK35_RS03230 Protein ID WP_003417282.1
Coordinates 709244..709672 (+) Length 143 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TI59
Locus tag PAK35_RS03225 Protein ID WP_003417286.1
Coordinates 708998..709240 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PAK35_RS03200 (PAK35_03200) 705462..706598 + 1137 WP_003417297.1 GTP 3',8-cyclase MoaA -
PAK35_RS03205 (PAK35_03205) 706695..707069 + 375 WP_003417295.1 4a-hydroxytetrahydrobiopterin dehydratase -
PAK35_RS03210 (PAK35_03210) 707066..707599 + 534 WP_003417293.1 cyclic pyranopterin monophosphate synthase MoaC -
PAK35_RS03215 (PAK35_03215) 707600..708265 + 666 WP_003417290.1 molybdopterin converting factor subunit 1 -
PAK35_RS03220 (PAK35_03220) 708262..708876 + 615 WP_003417288.1 class I SAM-dependent methyltransferase -
PAK35_RS03225 (PAK35_03225) 708998..709240 + 243 WP_003417286.1 CopG family transcriptional regulator Antitoxin
PAK35_RS03230 (PAK35_03230) 709244..709672 + 429 WP_003417282.1 type II toxin-antitoxin system VapC family toxin Toxin
PAK35_RS03235 (PAK35_03235) 709751..710542 - 792 WP_003417279.1 succinate dehydrogenase iron-sulfur subunit -
PAK35_RS03240 (PAK35_03240) 710542..712314 - 1773 WP_003417273.1 succinate dehydrogenase flavoprotein subunit -
PAK35_RS03245 (PAK35_03245) 712443..712877 - 435 WP_003902441.1 succinate dehydrogenase hydrophobic membrane anchor subunit -
PAK35_RS03250 (PAK35_03250) 712874..713212 - 339 WP_003417267.1 succinate dehydrogenase, cytochrome b556 subunit -
PAK35_RS03255 (PAK35_03255) 713449..713850 + 402 WP_003417264.1 cytidine deaminase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-141)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 143 a.a.        Molecular weight: 15834.16 Da        Isoelectric Point: 8.5471

>T267097 WP_003417282.1 NZ_CP115447:709244-709672 [Mycobacterium tuberculosis]
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL

Download         Length: 429 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8849.86 Da        Isoelectric Point: 5.1007

>AT267097 WP_003417286.1 NZ_CP115447:708998-709240 [Mycobacterium tuberculosis]
MRTTLSIDDDVLLAVKERARREKRTAGEILSDLARQALTNQNPQPAASQEDAFHGFEPLPHRGGAVSNALIDRLRDEEAV

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4FBL0

Antitoxin

Source ID Structure
AlphaFold DB G0TI59

References