Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC(toxin)
Location 701551..702194 Replicon chromosome
Accession NZ_CP115447
Organism Mycobacterium tuberculosis strain BLR 9248 2019

Toxin (Protein)


Gene name vapC Uniprot ID P67239
Locus tag PAK35_RS03175 Protein ID WP_003403187.1
Coordinates 701793..702194 (+) Length 134 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ91
Locus tag PAK35_RS03170 Protein ID WP_003403184.1
Coordinates 701551..701796 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PAK35_RS03135 (PAK35_03135) 696831..697361 - 531 WP_003917320.1 two component system sensor kinase HK2 -
PAK35_RS03140 (PAK35_03140) 697345..698040 - 696 WP_003918099.1 two-component system response regulator TcrA -
PAK35_RS03145 (PAK35_03145) 698163..698474 + 312 WP_003403164.1 hypothetical protein -
PAK35_RS03150 (PAK35_03150) 698546..699496 + 951 WP_003900184.1 DUF1259 domain-containing protein -
PAK35_RS03155 (PAK35_03155) 699737..700321 + 585 WP_003403171.1 IS607-like element IS1536 family transposase -
PAK35_RS03160 (PAK35_03160) 700323..701033 + 711 Protein_626 IS607 family element RNA-guided endonuclease TnpB -
PAK35_RS03165 (PAK35_03165) 701036..701506 + 471 WP_003898523.1 hypothetical protein -
PAK35_RS03170 (PAK35_03170) 701551..701796 + 246 WP_003403184.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PAK35_RS03175 (PAK35_03175) 701793..702194 + 402 WP_003403187.1 type II toxin-antitoxin system VapC family toxin Toxin
PAK35_RS03180 (PAK35_03180) 702185..702364 + 180 Protein_630 hypothetical protein -
PAK35_RS03185 (PAK35_03185) 702559..703320 + 762 Protein_631 IS3-like element IS987 family transposase -
PAK35_RS03190 (PAK35_03190) 703389..703649 + 261 WP_193567673.1 hypothetical protein -
PAK35_RS03195 (PAK35_03195) 703744..704889 - 1146 WP_003417299.1 BTAD domain-containing putative transcriptional regulator -
PAK35_RS03200 (PAK35_03200) 705462..706598 + 1137 WP_003417297.1 GTP 3',8-cyclase MoaA -
PAK35_RS03205 (PAK35_03205) 706695..707069 + 375 WP_003417295.1 4a-hydroxytetrahydrobiopterin dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn - - 699737..703320 3583


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(1-124)

Antitoxin

Antitoxin VapB-like

(1-80)


Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14501.21 Da        Isoelectric Point: 4.4463

>T267096 WP_003403187.1 NZ_CP115447:701793-702194 [Mycobacterium tuberculosis]
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR

Download         Length: 402 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 8813.12 Da        Isoelectric Point: 10.3486

>AT267096 WP_003403184.1 NZ_CP115447:701551-701796 [Mycobacterium tuberculosis]
MALNIKDPSVHQAVKQIAKITGESQARAVATAVNERLARLRSDDLAARLLAIGHKTASRMSPEAKRLDHDALLYDERGLP
A

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BSD6

Antitoxin

Source ID Structure
AlphaFold DB G0TQ91

References