Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 701551..702194 | Replicon | chromosome |
| Accession | NZ_CP115447 | ||
| Organism | Mycobacterium tuberculosis strain BLR 9248 2019 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P67239 |
| Locus tag | PAK35_RS03175 | Protein ID | WP_003403187.1 |
| Coordinates | 701793..702194 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TQ91 |
| Locus tag | PAK35_RS03170 | Protein ID | WP_003403184.1 |
| Coordinates | 701551..701796 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PAK35_RS03135 (PAK35_03135) | 696831..697361 | - | 531 | WP_003917320.1 | two component system sensor kinase HK2 | - |
| PAK35_RS03140 (PAK35_03140) | 697345..698040 | - | 696 | WP_003918099.1 | two-component system response regulator TcrA | - |
| PAK35_RS03145 (PAK35_03145) | 698163..698474 | + | 312 | WP_003403164.1 | hypothetical protein | - |
| PAK35_RS03150 (PAK35_03150) | 698546..699496 | + | 951 | WP_003900184.1 | DUF1259 domain-containing protein | - |
| PAK35_RS03155 (PAK35_03155) | 699737..700321 | + | 585 | WP_003403171.1 | IS607-like element IS1536 family transposase | - |
| PAK35_RS03160 (PAK35_03160) | 700323..701033 | + | 711 | Protein_626 | IS607 family element RNA-guided endonuclease TnpB | - |
| PAK35_RS03165 (PAK35_03165) | 701036..701506 | + | 471 | WP_003898523.1 | hypothetical protein | - |
| PAK35_RS03170 (PAK35_03170) | 701551..701796 | + | 246 | WP_003403184.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PAK35_RS03175 (PAK35_03175) | 701793..702194 | + | 402 | WP_003403187.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PAK35_RS03180 (PAK35_03180) | 702185..702364 | + | 180 | Protein_630 | hypothetical protein | - |
| PAK35_RS03185 (PAK35_03185) | 702559..703320 | + | 762 | Protein_631 | IS3-like element IS987 family transposase | - |
| PAK35_RS03190 (PAK35_03190) | 703389..703649 | + | 261 | WP_193567673.1 | hypothetical protein | - |
| PAK35_RS03195 (PAK35_03195) | 703744..704889 | - | 1146 | WP_003417299.1 | BTAD domain-containing putative transcriptional regulator | - |
| PAK35_RS03200 (PAK35_03200) | 705462..706598 | + | 1137 | WP_003417297.1 | GTP 3',8-cyclase MoaA | - |
| PAK35_RS03205 (PAK35_03205) | 706695..707069 | + | 375 | WP_003417295.1 | 4a-hydroxytetrahydrobiopterin dehydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 699737..703320 | 3583 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14501.21 Da Isoelectric Point: 4.4463
>T267096 WP_003403187.1 NZ_CP115447:701793-702194 [Mycobacterium tuberculosis]
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BSD6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQ91 |