267095

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/AbrB(antitoxin)
Location 695461..696107 Replicon chromosome
Accession NZ_CP115447
Organism Mycobacterium tuberculosis strain BLR 9248 2019

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ88
Locus tag PAK35_RS03120 Protein ID WP_003403137.1
Coordinates 695461..695874 (-) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ89
Locus tag PAK35_RS03125 Protein ID WP_003403139.1
Coordinates 695871..696107 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PAK35_RS03100 (PAK35_03100) 691544..693094 + 1551 WP_003905349.1 MCE family protein -
PAK35_RS03105 (PAK35_03105) 693146..693538 - 393 WP_003403122.1 type II toxin-antitoxin system toxin ribonuclease C4 -
PAK35_RS03110 (PAK35_03110) 693535..693792 - 258 WP_003403125.1 type II toxin-antitoxin system antitoxin VapB4 -
PAK35_RS03115 (PAK35_03115) 693975..695210 - 1236 WP_003403128.1 ATP-binding protein -
PAK35_RS03120 (PAK35_03120) 695461..695874 - 414 WP_003403137.1 type II toxin-antitoxin system VapC family toxin Toxin
PAK35_RS03125 (PAK35_03125) 695871..696107 - 237 WP_003403139.1 type II toxin-antitoxin system antitoxin VapB27 Antitoxin
PAK35_RS03130 (PAK35_03130) 696211..696717 - 507 WP_003900973.1 two component system sensor kinase HK1 -
PAK35_RS03135 (PAK35_03135) 696831..697361 - 531 WP_003917320.1 two component system sensor kinase HK2 -
PAK35_RS03140 (PAK35_03140) 697345..698040 - 696 WP_003918099.1 two-component system response regulator TcrA -
PAK35_RS03145 (PAK35_03145) 698163..698474 + 312 WP_003403164.1 hypothetical protein -
PAK35_RS03150 (PAK35_03150) 698546..699496 + 951 WP_003900184.1 DUF1259 domain-containing protein -
PAK35_RS03155 (PAK35_03155) 699737..700321 + 585 WP_003403171.1 IS607-like element IS1536 family transposase -
PAK35_RS03160 (PAK35_03160) 700323..701033 + 711 Protein_626 IS607 family element RNA-guided endonuclease TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-126)

Antitoxin

SpoVT-AbrB domain

(3-43)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 14786.14 Da        Isoelectric Point: 8.1405

>T267095 WP_003403137.1 NZ_CP115447:c695874-695461 [Mycobacterium tuberculosis]
VKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSR
TTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA

Download         Length: 414 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8212.41 Da        Isoelectric Point: 5.0351

>AT267095 WP_003403139.1 NZ_CP115447:c696107-695871 [Mycobacterium tuberculosis]
MKAVVDAAGRIVVPKPLREALGLQPGSTVEISRYGAGLHLIPTGRTARLEEENGVLVATGETTIDDEVVFGLIDSGRK

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ88

Antitoxin

Source ID Structure
AlphaFold DB G0TQ89

References