Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/AbrB(antitoxin) |
| Location | 695461..696107 | Replicon | chromosome |
| Accession | NZ_CP115447 | ||
| Organism | Mycobacterium tuberculosis strain BLR 9248 2019 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQ88 |
| Locus tag | PAK35_RS03120 | Protein ID | WP_003403137.1 |
| Coordinates | 695461..695874 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TQ89 |
| Locus tag | PAK35_RS03125 | Protein ID | WP_003403139.1 |
| Coordinates | 695871..696107 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PAK35_RS03100 (PAK35_03100) | 691544..693094 | + | 1551 | WP_003905349.1 | MCE family protein | - |
| PAK35_RS03105 (PAK35_03105) | 693146..693538 | - | 393 | WP_003403122.1 | type II toxin-antitoxin system toxin ribonuclease C4 | - |
| PAK35_RS03110 (PAK35_03110) | 693535..693792 | - | 258 | WP_003403125.1 | type II toxin-antitoxin system antitoxin VapB4 | - |
| PAK35_RS03115 (PAK35_03115) | 693975..695210 | - | 1236 | WP_003403128.1 | ATP-binding protein | - |
| PAK35_RS03120 (PAK35_03120) | 695461..695874 | - | 414 | WP_003403137.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PAK35_RS03125 (PAK35_03125) | 695871..696107 | - | 237 | WP_003403139.1 | type II toxin-antitoxin system antitoxin VapB27 | Antitoxin |
| PAK35_RS03130 (PAK35_03130) | 696211..696717 | - | 507 | WP_003900973.1 | two component system sensor kinase HK1 | - |
| PAK35_RS03135 (PAK35_03135) | 696831..697361 | - | 531 | WP_003917320.1 | two component system sensor kinase HK2 | - |
| PAK35_RS03140 (PAK35_03140) | 697345..698040 | - | 696 | WP_003918099.1 | two-component system response regulator TcrA | - |
| PAK35_RS03145 (PAK35_03145) | 698163..698474 | + | 312 | WP_003403164.1 | hypothetical protein | - |
| PAK35_RS03150 (PAK35_03150) | 698546..699496 | + | 951 | WP_003900184.1 | DUF1259 domain-containing protein | - |
| PAK35_RS03155 (PAK35_03155) | 699737..700321 | + | 585 | WP_003403171.1 | IS607-like element IS1536 family transposase | - |
| PAK35_RS03160 (PAK35_03160) | 700323..701033 | + | 711 | Protein_626 | IS607 family element RNA-guided endonuclease TnpB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 14786.14 Da Isoelectric Point: 8.1405
>T267095 WP_003403137.1 NZ_CP115447:c695874-695461 [Mycobacterium tuberculosis]
VKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSR
TTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA
VKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSR
TTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|