Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-PHD |
Location | 693146..693792 | Replicon | chromosome |
Accession | NZ_CP115447 | ||
Organism | Mycobacterium tuberculosis strain BLR 9248 2019 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | O07783 |
Locus tag | PAK35_RS03105 | Protein ID | WP_003403122.1 |
Coordinates | 693146..693538 (-) | Length | 131 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TQ86 |
Locus tag | PAK35_RS03110 | Protein ID | WP_003403125.1 |
Coordinates | 693535..693792 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAK35_RS03090 (PAK35_03090) | 688808..690334 | + | 1527 | WP_003403112.1 | virulence factor Mce family protein | - |
PAK35_RS03095 (PAK35_03095) | 690397..691539 | + | 1143 | WP_003911253.1 | virulence factor Mce family protein | - |
PAK35_RS03100 (PAK35_03100) | 691544..693094 | + | 1551 | WP_003905349.1 | MCE family protein | - |
PAK35_RS03105 (PAK35_03105) | 693146..693538 | - | 393 | WP_003403122.1 | type II toxin-antitoxin system toxin ribonuclease C4 | Toxin |
PAK35_RS03110 (PAK35_03110) | 693535..693792 | - | 258 | WP_003403125.1 | type II toxin-antitoxin system antitoxin VapB4 | Antitoxin |
PAK35_RS03115 (PAK35_03115) | 693975..695210 | - | 1236 | WP_003403128.1 | ATP-binding protein | - |
PAK35_RS03120 (PAK35_03120) | 695461..695874 | - | 414 | WP_003403137.1 | type II toxin-antitoxin system VapC family toxin | - |
PAK35_RS03125 (PAK35_03125) | 695871..696107 | - | 237 | WP_003403139.1 | type II toxin-antitoxin system antitoxin VapB27 | - |
PAK35_RS03130 (PAK35_03130) | 696211..696717 | - | 507 | WP_003900973.1 | two component system sensor kinase HK1 | - |
PAK35_RS03135 (PAK35_03135) | 696831..697361 | - | 531 | WP_003917320.1 | two component system sensor kinase HK2 | - |
PAK35_RS03140 (PAK35_03140) | 697345..698040 | - | 696 | WP_003918099.1 | two-component system response regulator TcrA | - |
PAK35_RS03145 (PAK35_03145) | 698163..698474 | + | 312 | WP_003403164.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14080.08 Da Isoelectric Point: 4.6558
>T267094 WP_003403122.1 NZ_CP115447:c693538-693146 [Mycobacterium tuberculosis]
VNVRRALADTSVFIGIEATRFDPDRFAGYEWGVSVVTLGELRLGVLQASGPEAAARRLSTYQLAQRFEPLGIDEAVSEAW
ALLVSKLRAAKLRVPINDSWIAATAVAHGIAILTQDNDYAAMPDVEVITI
VNVRRALADTSVFIGIEATRFDPDRFAGYEWGVSVVTLGELRLGVLQASGPEAAARRLSTYQLAQRFEPLGIDEAVSEAW
ALLVSKLRAAKLRVPINDSWIAATAVAHGIAILTQDNDYAAMPDVEVITI
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4F8V4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQ86 |