Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 676016..676635 | Replicon | chromosome |
Accession | NZ_CP115447 | ||
Organism | Mycobacterium tuberculosis strain BLR 9248 2019 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | O53779 |
Locus tag | PAK35_RS03040 | Protein ID | WP_003403047.1 |
Coordinates | 676228..676635 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | O53778 |
Locus tag | PAK35_RS03035 | Protein ID | WP_003403039.1 |
Coordinates | 676016..676231 (+) | Length | 72 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAK35_RS03025 (PAK35_03025) | 674544..675302 | + | 759 | WP_003898511.1 | Mut7-C RNAse domain-containing protein | - |
PAK35_RS03030 (PAK35_03030) | 675431..675922 | - | 492 | WP_003403017.1 | mycobacterial cell wall protein Rv0580c | - |
PAK35_RS03035 (PAK35_03035) | 676016..676231 | + | 216 | WP_003403039.1 | type II toxin-antitoxin system antitoxin VapB26 | Antitoxin |
PAK35_RS03040 (PAK35_03040) | 676228..676635 | + | 408 | WP_003403047.1 | type II toxin-antitoxin system toxin ribonuclease C26 | Toxin |
PAK35_RS03045 (PAK35_03045) | 676695..677381 | - | 687 | WP_003403052.1 | LpqN/LpqT family lipoprotein | - |
PAK35_RS03050 (PAK35_03050) | 677535..680168 | + | 2634 | WP_003403055.1 | GH92 family glycosyl hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14471.43 Da Isoelectric Point: 4.4493
>T267093 WP_003403047.1 NZ_CP115447:676228-676635 [Mycobacterium tuberculosis]
VIIDTSALLAYFDAAEPDHAAVSECIDSSADALVVSPYVVAELDYLVATRVGVDAELAVLRELAGGAWELANCGAAEIEQ
AARIVTKYQDQRIGIADAANVVLADRYRTRTILTLDRRHFSALRPIGGGRFTVIP
VIIDTSALLAYFDAAEPDHAAVSECIDSSADALVVSPYVVAELDYLVATRVGVDAELAVLRELAGGAWELANCGAAEIEQ
AARIVTKYQDQRIGIADAANVVLADRYRTRTILTLDRRHFSALRPIGGGRFTVIP
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 5X3T |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5X3T | |
AlphaFold DB | A0A7U4BSA2 |