Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-CcdA |
| Location | 638540..639216 | Replicon | chromosome |
| Accession | NZ_CP115447 | ||
| Organism | Mycobacterium tuberculosis strain BLR 9248 2019 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TPQ9 |
| Locus tag | PAK35_RS02870 | Protein ID | WP_003898500.1 |
| Coordinates | 638540..638953 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TPR0 |
| Locus tag | PAK35_RS02875 | Protein ID | WP_003402915.1 |
| Coordinates | 638950..639216 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PAK35_RS02840 (PAK35_02840) | 633885..634187 | - | 303 | WP_003402896.1 | DUF3349 domain-containing protein | - |
| PAK35_RS02845 (PAK35_02845) | 634247..634525 | - | 279 | WP_003402901.1 | hypothetical protein | - |
| PAK35_RS02850 (PAK35_02850) | 634522..635775 | - | 1254 | WP_003402904.1 | inorganic phosphate transporter | - |
| PAK35_RS02855 (PAK35_02855) | 635895..636281 | - | 387 | WP_003402907.1 | VOC family protein | - |
| PAK35_RS02860 (PAK35_02860) | 636344..637228 | - | 885 | WP_003402909.1 | SDR family oxidoreductase | - |
| PAK35_RS02865 (PAK35_02865) | 637324..638226 | - | 903 | WP_003915439.1 | 1,4-dihydroxy-2-naphthoyl-CoA synthase | - |
| PAK35_RS02870 (PAK35_02870) | 638540..638953 | - | 414 | WP_003898500.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PAK35_RS02875 (PAK35_02875) | 638950..639216 | - | 267 | WP_003402915.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| PAK35_RS02880 (PAK35_02880) | 639408..641123 | - | 1716 | WP_003402917.1 | fatty-acid--CoA ligase FadD8 | - |
| PAK35_RS02885 (PAK35_02885) | 641201..642805 | + | 1605 | WP_003402920.1 | amidohydrolase | - |
| PAK35_RS02890 (PAK35_02890) | 642802..643782 | + | 981 | WP_003402923.1 | o-succinylbenzoate synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 14667.78 Da Isoelectric Point: 7.3603
>T267092 WP_003898500.1 NZ_CP115447:c638953-638540 [Mycobacterium tuberculosis]
VRASPTSPPEQVVVDASAMVDLLARTSDRCSAVRARLARTAMHAPAHFDAEVLSALGRMQRAGALTVAYVDAALEELRQV
PVTRHGLSSLLAGAWSRRDTLRLTDALYVELAETAGLVLLTTDERLARAWPSAHAIG
VRASPTSPPEQVVVDASAMVDLLARTSDRCSAVRARLARTAMHAPAHFDAEVLSALGRMQRAGALTVAYVDAALEELRQV
PVTRHGLSSLLAGAWSRRDTLRLTDALYVELAETAGLVLLTTDERLARAWPSAHAIG
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|