Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 73142..73775 | Replicon | chromosome |
Accession | NZ_CP115447 | ||
Organism | Mycobacterium tuberculosis strain BLR 9248 2019 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WFC0 |
Locus tag | PAK35_RS00360 | Protein ID | WP_003400580.1 |
Coordinates | 73374..73775 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P0CW29 |
Locus tag | PAK35_RS00355 | Protein ID | WP_003400577.1 |
Coordinates | 73142..73381 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAK35_RS00340 (PAK35_00340) | 68437..69877 | + | 1441 | Protein_64 | FAD-binding oxidoreductase | - |
PAK35_RS00345 (PAK35_00345) | 69933..70094 | + | 162 | WP_003899796.1 | hypothetical protein | - |
PAK35_RS00350 (PAK35_00350) | 70135..73075 | + | 2941 | Protein_66 | UPF0182 family protein | - |
PAK35_RS00355 (PAK35_00355) | 73142..73381 | + | 240 | WP_003400577.1 | antitoxin VapB1 | Antitoxin |
PAK35_RS00360 (PAK35_00360) | 73374..73775 | + | 402 | WP_003400580.1 | type II toxin-antitoxin system ribonuclease VapC1 | Toxin |
PAK35_RS00365 (PAK35_00365) | 73827..76064 | - | 2238 | WP_003899797.1 | NADP-dependent isocitrate dehydrogenase | - |
PAK35_RS00370 (PAK35_00370) | 76182..76751 | - | 570 | WP_003400591.1 | TetR/AcrR family transcriptional regulator | - |
PAK35_RS00375 (PAK35_00375) | 76854..77765 | + | 912 | WP_003899798.1 | SDR family NAD(P)-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14339.44 Da Isoelectric Point: 4.8887
>T267087 WP_003400580.1 NZ_CP115447:73374-73775 [Mycobacterium tuberculosis]
VDECVVDAAAVVDALAGKGASAIVLRGLLKESISNAPHLLDAEVGHALRRAVLSDEISEEQARAALDALPYLIDNRYPHS
PRLIEYTWQLRHNVTFYDALYVALATALDVPLLTGDSRLAAAPGLPCEIKLVR
VDECVVDAAAVVDALAGKGASAIVLRGLLKESISNAPHLLDAEVGHALRRAVLSDEISEEQARAALDALPYLIDNRYPHS
PRLIEYTWQLRHNVTFYDALYVALATALDVPLLTGDSRLAAAPGLPCEIKLVR
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BR82 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CHM7 |