Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /SpoIISA(toxin) |
Location | 2331867..2332845 | Replicon | chromosome |
Accession | NZ_CP115307 | ||
Organism | Bacillus cereus strain BC-01 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | W8Y388 |
Locus tag | GVV68_RS16090 | Protein ID | WP_000624977.1 |
Coordinates | 2331867..2332604 (+) | Length | 246 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | GVV68_RS16095 | Protein ID | WP_000237820.1 |
Coordinates | 2332717..2332845 (+) | Length | 43 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GVV68_RS16065 (GVV68_16065) | 2327483..2327890 | + | 408 | WP_000063589.1 | VOC family protein | - |
GVV68_RS16070 (GVV68_16070) | 2327903..2328292 | + | 390 | Protein_2287 | SAM-dependent methyltransferase | - |
GVV68_RS16075 (GVV68_16075) | 2328450..2330135 | - | 1686 | WP_061655972.1 | alpha-keto acid decarboxylase family protein | - |
GVV68_RS16080 (GVV68_16080) | 2330243..2330725 | + | 483 | WP_000191888.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
GVV68_RS16085 (GVV68_16085) | 2330892..2331629 | + | 738 | WP_000594152.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
GVV68_RS16090 (GVV68_16090) | 2331867..2332604 | + | 738 | WP_000624977.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
GVV68_RS16095 (GVV68_16095) | 2332717..2332845 | + | 129 | WP_000237820.1 | hypothetical protein | Antitoxin |
GVV68_RS16100 (GVV68_16100) | 2332918..2333094 | + | 177 | WP_000852632.1 | stage II sporulation protein SB | - |
GVV68_RS16105 (GVV68_16105) | 2333113..2333502 | - | 390 | WP_000713867.1 | YxeA family protein | - |
GVV68_RS16110 (GVV68_16110) | 2333714..2335183 | + | 1470 | WP_000287515.1 | beta-Ala-His dipeptidase | - |
GVV68_RS16115 (GVV68_16115) | 2335429..2336238 | + | 810 | WP_000678508.1 | papain-like cysteine protease family protein | - |
GVV68_RS16120 (GVV68_16120) | 2336264..2336866 | + | 603 | WP_000517260.1 | hypothetical protein | - |
GVV68_RS16125 (GVV68_16125) | 2337107..2337358 | - | 252 | WP_000827560.1 | LuxR C-terminal-related transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 246 a.a. Molecular weight: 28307.03 Da Isoelectric Point: 8.2998
>T267084 WP_000624977.1 NZ_CP115307:2331867-2332604 [Bacillus cereus]
MISNIRIGLFVLAIVFVVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
MISNIRIGLFVLAIVFVVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
Download Length: 738 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|