Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 239592..240234 | Replicon | chromosome |
| Accession | NZ_CP115307 | ||
| Organism | Bacillus cereus strain BC-01 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | R8I8B8 |
| Locus tag | GVV68_RS05395 | Protein ID | WP_000635965.1 |
| Coordinates | 239884..240234 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | R8I8H2 |
| Locus tag | GVV68_RS05390 | Protein ID | WP_000004570.1 |
| Coordinates | 239592..239879 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GVV68_RS05365 (GVV68_05365) | 234909..235871 | + | 963 | WP_000961161.1 | UV DNA damage repair endonuclease UvsE | - |
| GVV68_RS05370 (GVV68_05370) | 235864..236436 | - | 573 | WP_000908523.1 | rhomboid family intramembrane serine protease | - |
| GVV68_RS05375 (GVV68_05375) | 236530..236889 | + | 360 | WP_087948187.1 | holo-ACP synthase | - |
| GVV68_RS05380 (GVV68_05380) | 237046..237996 | + | 951 | WP_002060618.1 | outer membrane lipoprotein carrier protein LolA | - |
| GVV68_RS05385 (GVV68_05385) | 238114..239283 | + | 1170 | WP_000390617.1 | alanine racemase | - |
| GVV68_RS05390 (GVV68_05390) | 239592..239879 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
| GVV68_RS05395 (GVV68_05395) | 239884..240234 | + | 351 | WP_000635965.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| GVV68_RS05400 (GVV68_05400) | 240302..242470 | + | 2169 | WP_000426236.1 | Tex family protein | - |
| GVV68_RS05405 (GVV68_05405) | 242528..242644 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
| GVV68_RS05410 (GVV68_05410) | 242840..243298 | + | 459 | WP_000344240.1 | SprT family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12948.04 Da Isoelectric Point: 5.7168
>T267083 WP_000635965.1 NZ_CP115307:239884-240234 [Bacillus cereus]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A366G118 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A366FY90 |