Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 2722374..2723016 | Replicon | chromosome |
| Accession | NZ_CP115303 | ||
| Organism | Bacillus tropicus strain JMT105-2 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | J8CWW5 |
| Locus tag | AVT_RS13900 | Protein ID | WP_000635963.1 |
| Coordinates | 2722374..2722724 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | R8I8H2 |
| Locus tag | AVT_RS13905 | Protein ID | WP_000004570.1 |
| Coordinates | 2722729..2723016 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AVT_RS13885 (AVT_13885) | 2719310..2719768 | - | 459 | WP_087967857.1 | SprT family protein | - |
| AVT_RS13890 (AVT_13890) | 2719964..2720080 | + | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
| AVT_RS13895 (AVT_13895) | 2720138..2722306 | - | 2169 | WP_270184594.1 | Tex family protein | - |
| AVT_RS13900 (AVT_13900) | 2722374..2722724 | - | 351 | WP_000635963.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| AVT_RS13905 (AVT_13905) | 2722729..2723016 | - | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
| AVT_RS13910 (AVT_13910) | 2723325..2724494 | - | 1170 | WP_048553601.1 | alanine racemase | - |
| AVT_RS13915 (AVT_13915) | 2724614..2725564 | - | 951 | WP_131102695.1 | outer membrane lipoprotein carrier protein LolA | - |
| AVT_RS13920 (AVT_13920) | 2725721..2726080 | - | 360 | WP_000635047.1 | holo-ACP synthase | - |
| AVT_RS13925 (AVT_13925) | 2726173..2726721 | + | 549 | WP_087967862.1 | rhomboid family intramembrane serine protease | - |
| AVT_RS13930 (AVT_13930) | 2726889..2727851 | - | 963 | WP_087967864.1 | UV DNA damage repair endonuclease UvsE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12974.12 Da Isoelectric Point: 5.7168
>T267082 WP_000635963.1 NZ_CP115303:c2722724-2722374 [Bacillus tropicus]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 4HKE | |
| PDB | 7BXY |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A366FY90 |