Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 712297..712961 | Replicon | chromosome |
Accession | NZ_CP115184 | ||
Organism | Janibacter cremeus strain SCSIO 52865 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | O9K63_RS03225 | Protein ID | WP_277240486.1 |
Coordinates | 712566..712961 (+) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | O9K63_RS03220 | Protein ID | WP_277240484.1 |
Coordinates | 712297..712569 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O9K63_RS03205 (O9K63_03205) | 709721..710344 | + | 624 | WP_277240478.1 | LON peptidase substrate-binding domain-containing protein | - |
O9K63_RS03210 (O9K63_03210) | 710412..711638 | - | 1227 | WP_277240480.1 | MFS transporter | - |
O9K63_RS03215 (O9K63_03215) | 711770..712078 | + | 309 | WP_277240482.1 | putative quinol monooxygenase | - |
O9K63_RS03220 (O9K63_03220) | 712297..712569 | + | 273 | WP_277240484.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
O9K63_RS03225 (O9K63_03225) | 712566..712961 | + | 396 | WP_277240486.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
O9K63_RS03230 (O9K63_03230) | 712969..713784 | - | 816 | WP_277240488.1 | class I SAM-dependent methyltransferase | - |
O9K63_RS03235 (O9K63_03235) | 713928..715421 | + | 1494 | WP_277240489.1 | methyltransferase domain-containing protein | - |
O9K63_RS03240 (O9K63_03240) | 715388..716074 | - | 687 | WP_277240490.1 | dihydrofolate reductase family protein | - |
O9K63_RS03245 (O9K63_03245) | 716071..716958 | - | 888 | WP_277240492.1 | lysylphosphatidylglycerol synthase transmembrane domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 691654..713784 | 22130 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14200.87 Da Isoelectric Point: 4.2433
>T267076 WP_277240486.1 NZ_CP115184:712566-712961 [Janibacter cremeus]
MIIDTSALVAIITGEPEADRLLTAIAEAESARMSAATYVECAIVIDRRSSPATRRRFDQLLTTLEIGIADLTADQAQIAR
EAHRDFGRGSEGRARLNLGDCYSYALAVASDDELLFQGDDFSATDIVAARY
MIIDTSALVAIITGEPEADRLLTAIAEAESARMSAATYVECAIVIDRRSSPATRRRFDQLLTTLEIGIADLTADQAQIAR
EAHRDFGRGSEGRARLNLGDCYSYALAVASDDELLFQGDDFSATDIVAARY
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|