Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1813217..1814007 | Replicon | chromosome |
Accession | NZ_CP115182 | ||
Organism | Diaphorobacter sp. ED-3 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | PCQ86_RS08960 | Protein ID | WP_270175309.1 |
Coordinates | 1813507..1814007 (+) | Length | 167 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | - |
Locus tag | PCQ86_RS08955 | Protein ID | WP_270175308.1 |
Coordinates | 1813217..1813510 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PCQ86_RS08935 | 1810393..1811049 | + | 657 | WP_011805663.1 | OmpA family protein | - |
PCQ86_RS08940 | 1811129..1811842 | + | 714 | WP_270175307.1 | bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG | - |
PCQ86_RS08945 | 1811839..1812516 | + | 678 | WP_047349155.1 | HAD-IA family hydrolase | - |
PCQ86_RS08955 | 1813217..1813510 | + | 294 | WP_270175308.1 | DUF1778 domain-containing protein | Antitoxin |
PCQ86_RS08960 | 1813507..1814007 | + | 501 | WP_270175309.1 | GNAT family N-acetyltransferase | Toxin |
PCQ86_RS08965 | 1814172..1814456 | + | 285 | WP_270175310.1 | helix-turn-helix transcriptional regulator | - |
PCQ86_RS08970 | 1814469..1814906 | - | 438 | WP_270175311.1 | hypothetical protein | - |
PCQ86_RS08975 | 1815182..1815811 | + | 630 | WP_270175312.1 | integrase arm-type DNA-binding domain-containing protein | - |
PCQ86_RS08980 | 1816007..1816255 | + | 249 | WP_270175313.1 | helix-turn-helix transcriptional regulator | - |
PCQ86_RS08990 | 1816566..1817585 | - | 1020 | WP_015913677.1 | class 1 fructose-bisphosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 167 a.a. Molecular weight: 18362.21 Da Isoelectric Point: 10.0337
>T267071 WP_270175309.1 NZ_CP115182:1813507-1814007 [Diaphorobacter sp. ED-3]
VTLRAPEPLAAQHRLEGFDCGKPALNDWLLRHARQAQGSGSAKTFVVAEDDGRVAGYFSLTVGQVDTLEAPERIRKGMGQ
YPLPVVILARLAVSVADQGRGIGFGLLQDAIRRTMLIAEQAGIRAMLTHPIDEEAARFYTRFGFIASPLRDQQLLLLLKD
ARRWVR
VTLRAPEPLAAQHRLEGFDCGKPALNDWLLRHARQAQGSGSAKTFVVAEDDGRVAGYFSLTVGQVDTLEAPERIRKGMGQ
YPLPVVILARLAVSVADQGRGIGFGLLQDAIRRTMLIAEQAGIRAMLTHPIDEEAARFYTRFGFIASPLRDQQLLLLLKD
ARRWVR
Download Length: 501 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|