Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PP_4151-4152/excise(antitoxin)
Location 1419896..1420938 Replicon chromosome
Accession NZ_CP115182
Organism Diaphorobacter sp. ED-3

Toxin (Protein)


Gene name PP_4152 Uniprot ID -
Locus tag PCQ86_RS06900 Protein ID WP_003153636.1
Coordinates 1420363..1420938 (+) Length 192 a.a.

Antitoxin (Protein)


Gene name PP_4151 Uniprot ID I3TV68
Locus tag PCQ86_RS06895 Protein ID WP_003050245.1
Coordinates 1419896..1420366 (+) Length 157 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PCQ86_RS06860 1415279..1416709 - 1431 WP_011804670.1 TIGR03752 family integrating conjugative element protein -
PCQ86_RS06865 1416699..1417607 - 909 WP_009516219.1 TIGR03749 family integrating conjugative element protein -
PCQ86_RS06870 1417604..1418296 - 693 WP_009516220.1 TIGR03746 family integrating conjugative element protein -
PCQ86_RS06875 1418293..1418691 - 399 WP_009516221.1 TIGR03750 family conjugal transfer protein -
PCQ86_RS06880 1418703..1419062 - 360 WP_003090173.1 TIGR03745 family integrating conjugative element membrane protein -
PCQ86_RS06885 1419079..1419312 - 234 WP_270175142.1 TIGR03758 family integrating conjugative element protein -
PCQ86_RS06890 1419309..1419692 - 384 WP_011804671.1 RAQPRD family integrative conjugative element protein -
PCQ86_RS06895 1419896..1420366 + 471 WP_003050245.1 helix-turn-helix domain-containing protein Antitoxin
PCQ86_RS06900 1420363..1420938 + 576 WP_003153636.1 PIN domain-containing protein Toxin
PCQ86_RS06905 1420956..1421870 + 915 WP_003050256.1 AAA family ATPase -
PCQ86_RS06910 1421867..1422337 + 471 WP_011804672.1 type III CBASS phage resistance system CD-NTase-associated protein Cap8 -
PCQ86_RS06915 1422334..1422834 + 501 WP_011804673.1 type III CBASS phage resistance system CD-NTase-associated protein Cap7 -
PCQ86_RS06920 1422834..1423736 + 903 WP_011804674.1 CBASS oligonucleotide cyclase -
PCQ86_RS06925 1423775..1424500 + 726 WP_003050273.1 CBASS effector endonuclease NucC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1382748..1424500 41752


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(9-114)

Antitoxin

Helix-turn-helix domain, group 17

(85-133)


Sequences

Toxin        


Download         Length: 192 a.a.        Molecular weight: 21629.78 Da        Isoelectric Point: 5.9995

>T267070 WP_003153636.1 NZ_CP115182:1420363-1420938 [Diaphorobacter sp. ED-3]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL

Download         Length: 576 bp

Antitoxin


Download         Length: 157 a.a.        Molecular weight: 17245.62 Da        Isoelectric Point: 6.3803

>AT267070 WP_003050245.1 NZ_CP115182:1419896-1420366 [Diaphorobacter sp. ED-3]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE

Download         Length: 471 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB I3TV68

References