Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) BrnTA/BrnT-BrnA
Location 961215..961774 Replicon chromosome
Accession NZ_CP115176
Organism Brucella melitensis strain TZ

Toxin (Protein)


Gene name brnT Uniprot ID A0A7U8PD14
Locus tag O5K87_RS04800 Protein ID WP_002966807.1
Coordinates 961529..961774 (-) Length 82 a.a.

Antitoxin (Protein)


Gene name brnA Uniprot ID C0RIV1
Locus tag O5K87_RS04795 Protein ID WP_004683740.1
Coordinates 961215..961529 (-) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O5K87_RS04745 (O5K87_04745) 956920..957123 - 204 WP_004683737.1 hypothetical protein -
O5K87_RS04750 (O5K87_04750) 957126..957341 - 216 WP_005968947.1 hypothetical protein -
O5K87_RS04755 (O5K87_04755) 957338..957541 - 204 WP_002964088.1 hypothetical protein -
O5K87_RS04760 (O5K87_04760) 957591..958295 + 705 WP_005968944.1 hypothetical protein -
O5K87_RS04765 (O5K87_04765) 958292..958522 + 231 WP_002964091.1 hypothetical protein -
O5K87_RS04770 (O5K87_04770) 958519..958794 + 276 WP_002964092.1 hypothetical protein -
O5K87_RS04775 (O5K87_04775) 958886..959293 + 408 WP_002971458.1 hypothetical protein -
O5K87_RS04780 (O5K87_04780) 959639..960349 + 711 WP_004683739.1 porin family protein -
O5K87_RS04785 (O5K87_04785) 960697..960867 - 171 WP_002964095.1 DUF1508 domain-containing protein -
O5K87_RS04790 (O5K87_04790) 960866..961099 + 234 WP_002969999.1 hypothetical protein -
O5K87_RS04795 (O5K87_04795) 961215..961529 - 315 WP_004683740.1 BrnA antitoxin family protein Antitoxin
O5K87_RS04800 (O5K87_04800) 961529..961774 - 246 WP_002966807.1 BrnT family toxin Toxin
O5K87_RS04805 (O5K87_04805) 961907..962545 + 639 Protein_942 tRNA guanosine transglycosylase -
O5K87_RS04810 (O5K87_04810) 962615..963373 + 759 Protein_943 IS5 family transposase -
O5K87_RS04815 (O5K87_04815) 963374..964147 + 774 Protein_944 hypothetical protein -
O5K87_RS04820 (O5K87_04820) 964478..965929 + 1452 WP_006135932.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - wboA / wbdA 955148..969245 14097
- flank IS/Tn - - 962615..962983 368


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Ribonuclease toxin, BrnT, of type II toxin-antitoxin system

(5-78)

Antitoxin

BrnA antitoxin of type II toxin-antitoxin system

(28-102)


Sequences

Toxin        


Download         Length: 82 a.a.        Molecular weight: 9162.82 Da        Isoelectric Point: 10.3158

>T267068 WP_002966807.1 NZ_CP115176:c961774-961529 [Brucella melitensis]
MKIIWDEPKRQTNIAKHGLDFADLHFEFFLSAKVFPTKADRLMAIGEFNGLIIIAVIFKPVGSEALSVISMRSASQKERK
L

Download         Length: 246 bp

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 11653.48 Da        Isoelectric Point: 10.5824

>AT267068 WP_004683740.1 NZ_CP115176:c961529-961215 [Brucella melitensis]
MGIKFSSKRPLTQEEEAEIQKMIASDPDAPEATDKQLAKAKPFKESFPDMAAKMEKAIRGRPRIDNPKTPVTIRLDQDVV
QRFKATGKGWQGRMNDALRKAVGL

Download         Length: 315 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U8PD14

Antitoxin

Source ID Structure
AlphaFold DB C0RIV1

References