Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relB-yefM/YoeB-YefM |
Location | 44614..45122 | Replicon | chromosome |
Accession | NZ_CP115175 | ||
Organism | Homoserinibacter sp. YIM 151385 |
Toxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | OF852_RS00225 | Protein ID | WP_271119810.1 |
Coordinates | 44859..45122 (+) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | OF852_RS00220 | Protein ID | WP_271119809.1 |
Coordinates | 44614..44862 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OF852_RS00200 (OF852_00200) | 40321..40893 | - | 573 | WP_271119806.1 | CGNR zinc finger domain-containing protein | - |
OF852_RS00205 (OF852_00205) | 40971..42284 | + | 1314 | WP_271119807.1 | EamA family transporter | - |
OF852_RS00210 (OF852_00210) | 42281..43246 | + | 966 | WP_271119808.1 | DMT family transporter | - |
OF852_RS00215 (OF852_00215) | 43296..44579 | + | 1284 | WP_271121187.1 | ATP phosphoribosyltransferase regulatory subunit | - |
OF852_RS00220 (OF852_00220) | 44614..44862 | + | 249 | WP_271119809.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
OF852_RS00225 (OF852_00225) | 44859..45122 | + | 264 | WP_271119810.1 | Txe/YoeB family addiction module toxin | Toxin |
OF852_RS00230 (OF852_00230) | 45205..46485 | + | 1281 | WP_271119811.1 | phosphopyruvate hydratase | - |
OF852_RS00235 (OF852_00235) | 46607..47113 | + | 507 | WP_271119812.1 | septum formation initiator family protein | - |
OF852_RS00240 (OF852_00240) | 47110..47625 | + | 516 | WP_271119813.1 | DUF501 domain-containing protein | - |
OF852_RS00245 (OF852_00245) | 47670..48872 | + | 1203 | WP_271121188.1 | S8 family serine peptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10273.72 Da Isoelectric Point: 8.5038
>T267067 WP_271119810.1 NZ_CP115175:44859-45122 [Homoserinibacter sp. YIM 151385]
MTRRLVWVDEAWEDYLHWQGQDRKTLKRINLLIADVRRGDPFEGIGKPEPLKHALAGAWSRRIDDVNRLVYIADAESVTI
LQARYHY
MTRRLVWVDEAWEDYLHWQGQDRKTLKRINLLIADVRRGDPFEGIGKPEPLKHALAGAWSRRIDDVNRLVYIADAESVTI
LQARYHY
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|