Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-yefM/YoeB-YefM |
Location | 4303937..4304454 | Replicon | chromosome |
Accession | NZ_CP115174 | ||
Organism | Sphingomonas sp. PAMB00755 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | PBT88_RS20390 | Protein ID | WP_270077102.1 |
Coordinates | 4303937..4304203 (-) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | PBT88_RS20395 | Protein ID | WP_270077103.1 |
Coordinates | 4304200..4304454 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PBT88_RS20370 (PBT88_20370) | 4299200..4299934 | + | 735 | WP_270077099.1 | sterol desaturase family protein | - |
PBT88_RS20375 (PBT88_20375) | 4299944..4300423 | - | 480 | WP_270079333.1 | hypothetical protein | - |
PBT88_RS20380 (PBT88_20380) | 4300734..4302665 | + | 1932 | WP_270077100.1 | phosphomethylpyrimidine synthase ThiC | - |
PBT88_RS20385 (PBT88_20385) | 4302695..4303882 | - | 1188 | WP_270077101.1 | hypothetical protein | - |
PBT88_RS20390 (PBT88_20390) | 4303937..4304203 | - | 267 | WP_270077102.1 | Txe/YoeB family addiction module toxin | Toxin |
PBT88_RS20395 (PBT88_20395) | 4304200..4304454 | - | 255 | WP_270077103.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
PBT88_RS20400 (PBT88_20400) | 4304492..4305202 | - | 711 | WP_270077104.1 | uracil-DNA glycosylase | - |
PBT88_RS20405 (PBT88_20405) | 4305300..4305620 | + | 321 | WP_270077105.1 | hypothetical protein | - |
PBT88_RS20410 (PBT88_20410) | 4305637..4305858 | - | 222 | WP_270077106.1 | hypothetical protein | - |
PBT88_RS20415 (PBT88_20415) | 4305982..4306533 | + | 552 | WP_270077107.1 | hypothetical protein | - |
PBT88_RS20420 (PBT88_20420) | 4306569..4308194 | - | 1626 | WP_270077108.1 | NAD(P)/FAD-dependent oxidoreductase | - |
PBT88_RS20425 (PBT88_20425) | 4308195..4309415 | - | 1221 | WP_270077109.1 | aromatic ring-hydroxylating dioxygenase subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10177.57 Da Isoelectric Point: 9.7893
>T267066 WP_270077102.1 NZ_CP115174:c4304203-4303937 [Sphingomonas sp. PAMB00755]
VKITFSSVAWDHYLYWQAEDAKVLARLNALLKECQRDPFRGTGKPEPLGGNLSGWWSRRINSEHRLVYRVAGKGDRQALE
VAACRYHY
VKITFSSVAWDHYLYWQAEDAKVLARLNALLKECQRDPFRGTGKPEPLGGNLSGWWSRRINSEHRLVYRVAGKGDRQALE
VAACRYHY
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|