Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-RHH |
Location | 313003..313598 | Replicon | chromosome |
Accession | NZ_CP115174 | ||
Organism | Sphingomonas sp. PAMB00755 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PBT88_RS01565 | Protein ID | WP_270077502.1 |
Coordinates | 313003..313389 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PBT88_RS01570 | Protein ID | WP_270077503.1 |
Coordinates | 313383..313598 (-) | Length | 72 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PBT88_RS01560 (PBT88_01560) | 311299..312981 | - | 1683 | WP_270079137.1 | recombinase family protein | - |
PBT88_RS01565 (PBT88_01565) | 313003..313389 | - | 387 | WP_270077502.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PBT88_RS01570 (PBT88_01570) | 313383..313598 | - | 216 | WP_270077503.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
PBT88_RS01575 (PBT88_01575) | 313675..313869 | - | 195 | WP_270077504.1 | hypothetical protein | - |
PBT88_RS01580 (PBT88_01580) | 313850..314092 | - | 243 | WP_270077505.1 | AlpA family phage regulatory protein | - |
PBT88_RS01585 (PBT88_01585) | 314474..315502 | - | 1029 | WP_270077506.1 | hypothetical protein | - |
PBT88_RS01590 (PBT88_01590) | 316202..316819 | + | 618 | WP_270077507.1 | hypothetical protein | - |
PBT88_RS01595 (PBT88_01595) | 316812..317390 | + | 579 | WP_270077508.1 | sigma-70 family RNA polymerase sigma factor | - |
PBT88_RS01600 (PBT88_01600) | 317463..317720 | - | 258 | WP_270077509.1 | conjugal transfer protein TraD | - |
PBT88_RS01605 (PBT88_01605) | 317734..318060 | - | 327 | WP_270077510.1 | conjugal transfer protein TraD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 311322..362247 | 50925 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14165.31 Da Isoelectric Point: 5.1663
>T267063 WP_270077502.1 NZ_CP115174:c313389-313003 [Sphingomonas sp. PAMB00755]
MVGALFDTNILIDHLNAIPQARKEIARYGDPAISIVTWMEVMVGAGAELVEPTRRFLDGFAVVELDNDIAERAVSLRRSH
RIKLPDAIIWATAQVAGRILVTRNTKDFPTDDPGIREPYAIWGSVSPI
MVGALFDTNILIDHLNAIPQARKEIARYGDPAISIVTWMEVMVGAGAELVEPTRRFLDGFAVVELDNDIAERAVSLRRSH
RIKLPDAIIWATAQVAGRILVTRNTKDFPTDDPGIREPYAIWGSVSPI
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|