Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3219908..3220544 | Replicon | chromosome |
Accession | NZ_CP115172 | ||
Organism | Bacillus safensis strain BS-10L |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A0P7G713 |
Locus tag | ORQ91_RS16445 | Protein ID | WP_024425388.1 |
Coordinates | 3219908..3220258 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | W8QJ31 |
Locus tag | ORQ91_RS16450 | Protein ID | WP_003214273.1 |
Coordinates | 3220263..3220544 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORQ91_RS16405 (ORQ91_03283) | 3214939..3215538 | - | 600 | WP_024425395.1 | PP2C family serine/threonine-protein phosphatase | - |
ORQ91_RS16410 (ORQ91_03284) | 3215538..3216326 | - | 789 | WP_024425394.1 | RNA polymerase sigma factor SigB | - |
ORQ91_RS16415 (ORQ91_03285) | 3216292..3216780 | - | 489 | WP_024425393.1 | anti-sigma B factor RsbW | - |
ORQ91_RS16420 (ORQ91_03286) | 3216777..3217106 | - | 330 | WP_024425392.1 | anti-sigma factor antagonist | - |
ORQ91_RS16425 (ORQ91_03287) | 3217166..3218173 | - | 1008 | WP_024425391.1 | PP2C family protein-serine/threonine phosphatase | - |
ORQ91_RS16430 (ORQ91_03288) | 3218184..3218585 | - | 402 | WP_073203956.1 | anti-sigma regulatory factor | - |
ORQ91_RS16435 (ORQ91_03289) | 3218588..3218956 | - | 369 | WP_003214235.1 | RsbT antagonist protein RsbS | - |
ORQ91_RS16440 (ORQ91_03290) | 3218961..3219791 | - | 831 | WP_044334717.1 | RsbT co-antagonist protein RsbRA | - |
ORQ91_RS16445 (ORQ91_03291) | 3219908..3220258 | - | 351 | WP_024425388.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
ORQ91_RS16450 (ORQ91_03292) | 3220263..3220544 | - | 282 | WP_003214273.1 | hypothetical protein | Antitoxin |
ORQ91_RS16455 (ORQ91_03293) | 3220839..3222014 | - | 1176 | WP_103132680.1 | alanine racemase | - |
ORQ91_RS16460 (ORQ91_03294) | 3222156..3223172 | - | 1017 | WP_087975235.1 | outer membrane lipoprotein-sorting protein | - |
ORQ91_RS16465 (ORQ91_03295) | 3223333..3223698 | - | 366 | WP_047202005.1 | holo-ACP synthase | - |
ORQ91_RS16470 (ORQ91_03296) | 3223793..3224398 | + | 606 | WP_024425384.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8891
>T267062 WP_024425388.1 NZ_CP115172:c3220258-3219908 [Bacillus safensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0P7G713 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A081L854 |