Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
| Location | 1197654..1198571 | Replicon | chromosome |
| Accession | NZ_CP115158 | ||
| Organism | Bacillus amyloliquefaciens strain MBLB 0692 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | - |
| Locus tag | O7R04_RS06280 | Protein ID | WP_025851786.1 |
| Coordinates | 1197825..1198571 (-) | Length | 249 a.a. |
Antitoxin (Protein)
| Gene name | spoIISB | Uniprot ID | I2HQ14 |
| Locus tag | O7R04_RS06275 | Protein ID | WP_003154807.1 |
| Coordinates | 1197654..1197824 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O7R04_RS06235 (O7R04_06235) | 1192885..1194507 | + | 1623 | WP_058905960.1 | pyocin knob domain-containing protein | - |
| O7R04_RS06240 (O7R04_06240) | 1194520..1194891 | + | 372 | WP_014304856.1 | XkdW family protein | - |
| O7R04_RS06245 (O7R04_06245) | 1194897..1195094 | + | 198 | WP_003154819.1 | XkdX family protein | - |
| O7R04_RS06250 (O7R04_06250) | 1195151..1195912 | + | 762 | WP_058905961.1 | hypothetical protein | - |
| O7R04_RS06255 (O7R04_06255) | 1195964..1196227 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
| O7R04_RS06260 (O7R04_06260) | 1196241..1196504 | + | 264 | WP_003154813.1 | phage holin | - |
| O7R04_RS06265 (O7R04_06265) | 1196518..1197396 | + | 879 | WP_014304858.1 | N-acetylmuramoyl-L-alanine amidase | - |
| O7R04_RS06270 (O7R04_06270) | 1197432..1197557 | - | 126 | WP_003154809.1 | hypothetical protein | - |
| O7R04_RS06275 (O7R04_06275) | 1197654..1197824 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
| O7R04_RS06280 (O7R04_06280) | 1197825..1198571 | - | 747 | WP_025851786.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
| O7R04_RS06285 (O7R04_06285) | 1198675..1199673 | - | 999 | WP_003154805.1 | inorganic phosphate transporter | - |
| O7R04_RS06290 (O7R04_06290) | 1199686..1200303 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
| O7R04_RS06295 (O7R04_06295) | 1200589..1201905 | - | 1317 | WP_003154801.1 | amino acid permease | - |
| O7R04_RS06300 (O7R04_06300) | 1202229..1203179 | + | 951 | WP_015388352.1 | ring-cleaving dioxygenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29048.53 Da Isoelectric Point: 4.7003
>T267060 WP_025851786.1 NZ_CP115158:c1198571-1197825 [Bacillus amyloliquefaciens]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CEYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CEYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|