Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 470435..471072 | Replicon | chromosome |
Accession | NZ_CP115158 | ||
Organism | Bacillus amyloliquefaciens strain MBLB 0692 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | O7R04_RS02460 | Protein ID | WP_003156187.1 |
Coordinates | 470722..471072 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | O7R04_RS02455 | Protein ID | WP_003156188.1 |
Coordinates | 470435..470716 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O7R04_RS02435 (O7R04_02435) | 466800..467399 | - | 600 | WP_139885531.1 | rhomboid family intramembrane serine protease | - |
O7R04_RS02440 (O7R04_02440) | 467492..467857 | + | 366 | WP_014304402.1 | holo-ACP synthase | - |
O7R04_RS02445 (O7R04_02445) | 468022..469029 | + | 1008 | WP_003156191.1 | outer membrane lipoprotein carrier protein LolA | - |
O7R04_RS02450 (O7R04_02450) | 469146..470315 | + | 1170 | WP_003156189.1 | alanine racemase | - |
O7R04_RS02455 (O7R04_02455) | 470435..470716 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
O7R04_RS02460 (O7R04_02460) | 470722..471072 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
O7R04_RS02465 (O7R04_02465) | 471190..472011 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
O7R04_RS02470 (O7R04_02470) | 472016..472381 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
O7R04_RS02475 (O7R04_02475) | 472384..472785 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
O7R04_RS02480 (O7R04_02480) | 472797..473804 | + | 1008 | WP_003156177.1 | PP2C family protein-serine/threonine phosphatase | - |
O7R04_RS02485 (O7R04_02485) | 473868..474197 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
O7R04_RS02490 (O7R04_02490) | 474194..474676 | + | 483 | WP_003156173.1 | anti-sigma B factor RsbW | - |
O7R04_RS02495 (O7R04_02495) | 474642..475430 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
O7R04_RS02500 (O7R04_02500) | 475430..476032 | + | 603 | WP_003156170.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T267059 WP_003156187.1 NZ_CP115158:470722-471072 [Bacillus amyloliquefaciens]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|